BLASTX nr result
ID: Paeonia22_contig00044897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044897 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031854.1| Galactose oxidase/kelch repeat superfamily p... 55 8e-06 >ref|XP_007031854.1| Galactose oxidase/kelch repeat superfamily protein, putative [Theobroma cacao] gi|508710883|gb|EOY02780.1| Galactose oxidase/kelch repeat superfamily protein, putative [Theobroma cacao] Length = 405 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +2 Query: 131 AKNWKILERFPAKADLNTGWGVAF*SLGNELLVIDFLNS*YKSWHMTIYPC 283 + WK L P +ADL+ GWGVAF SLGNELLVI F +S S MTIY C Sbjct: 323 SNTWKKLGPVPVRADLHRGWGVAFKSLGNELLVIGFSSS-GSSQAMTIYTC 372