BLASTX nr result
ID: Paeonia22_contig00044845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044845 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CBI19926.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] 64 2e-08 >ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Vitis vinifera] Length = 665 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 239 RNHEFVFMSTQLLHYGGKEIYSILELLMREMKNEGYIYEQYDKVGAEGE 93 +NH FVF QLLH GGK+IY IL LL++E++++GY +QYDKV A GE Sbjct: 615 KNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVGE 663 >emb|CBI19926.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 239 RNHEFVFMSTQLLHYGGKEIYSILELLMREMKNEGYIYEQYDKVGAEGE 93 +NH FVF QLLH GGK+IY IL LL++E++++GY +QYDKV A GE Sbjct: 362 KNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVGE 410 >emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] Length = 1796 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 239 RNHEFVFMSTQLLHYGGKEIYSILELLMREMKNEGYIYEQYDKVGAEGE 93 +NH FVF QLLH GGK+IY IL LL++E++++GY +QYDKV A GE Sbjct: 1288 KNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVGE 1336