BLASTX nr result
ID: Paeonia22_contig00044681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044681 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034763.1| 2Fe-2S ferredoxin-like superfamily protein, ... 56 6e-06 >ref|XP_007034763.1| 2Fe-2S ferredoxin-like superfamily protein, partial [Theobroma cacao] gi|508713792|gb|EOY05689.1| 2Fe-2S ferredoxin-like superfamily protein, partial [Theobroma cacao] Length = 224 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = -1 Query: 190 EKKNMATLRFTTPRPRPLCVTKQKYPTKLSAFQLNPRTRSVSRRRPYSGIIVRSYKVVVE 11 +K MATL FT P P + + PT L+ QLNPR R S R +S +I RSYKVV+E Sbjct: 74 QKGTMATLHFT---PSPSFILNKPRPTTLATSQLNPRARHGSLR--FSTVIARSYKVVIE 128 Query: 10 HEG 2 HEG Sbjct: 129 HEG 131