BLASTX nr result
ID: Paeonia22_contig00044370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044370 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfam... 79 7e-13 emb|CBI16890.3| unnamed protein product [Vitis vinifera] 79 8e-13 ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containi... 79 8e-13 emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] 79 8e-13 ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prun... 72 1e-10 ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Popu... 70 4e-10 ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phas... 64 2e-08 ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citr... 64 2e-08 ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 gb|EXB85827.1| hypothetical protein L484_009673 [Morus notabilis] 62 8e-08 ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_003627859.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 ref|NP_198689.1| pentatricopeptide repeat-containing protein [Ar... 60 3e-07 ref|XP_006405706.1| hypothetical protein EUTSA_v10028323mg [Eutr... 59 5e-07 ref|XP_006282941.1| hypothetical protein CARUB_v10007510mg [Caps... 58 1e-06 ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 55 8e-06 >ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508712456|gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 593 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQPKL 167 M +RRLMIT K+YRCFNASYA D +I+G FWN+V+ERGL+SK+ L+ +QQ KL Sbjct: 539 MYKRRLMITLKIYRCFNASYADDNSILGFFWNHVVERGLMSKSILKDIQQRKL 591 >emb|CBI16890.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 D M +RRLMIT K+YRCF+ASYAGD +I+G+FW++VIER LISKN L+++QQ Sbjct: 527 DEMDKRRLMITLKIYRCFSASYAGDGSILGLFWDHVIERRLISKNILKYIQQ 578 >ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Vitis vinifera] Length = 590 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 D M +RRLMIT K+YRCF+ASYAGD +I+G+FW++VIER LISKN L+++QQ Sbjct: 534 DEMDKRRLMITLKIYRCFSASYAGDGSILGLFWDHVIERRLISKNILKYIQQ 585 >emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 D M +RRLMIT K+YRCF+ASYAGD +I+G+FW++VIER LISKN L+++QQ Sbjct: 534 DEMDKRRLMITLKIYRCFSASYAGDGSILGLFWDHVIERRLISKNILKYIQQ 585 >ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] gi|462403897|gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] Length = 589 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTL-RHMQQ 158 D M +RRLM+T K+YRCFNASYA D +II +FW++++ERGL+SKN + + MQQ Sbjct: 536 DEMYKRRLMVTRKIYRCFNASYASDNDIIRLFWDHMVERGLMSKNVINKEMQQ 588 >ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa] gi|550320321|gb|ERP51296.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa] Length = 593 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQ 155 D M ++RLMIT K+YR FNASYA D +I+ +FWN+V+ER L+SKN L+ MQ Sbjct: 543 DEMYKKRLMITLKIYRSFNASYASDNSILSLFWNHVLERRLMSKNILKDMQ 593 >ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] Length = 587 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 M RRLMIT KLYRCF+ S A + + IFWN+V++RGL+S+NT+ +QQ Sbjct: 535 MARRRLMITVKLYRCFSTSDANENKVSQIFWNHVMDRGLMSRNTMNKIQQ 584 >ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263178|ref|XP_007133768.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263180|ref|XP_007133769.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006767|gb|ESW05761.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006768|gb|ESW05762.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006769|gb|ESW05763.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] Length = 587 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/50 (54%), Positives = 39/50 (78%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 MT RRLMIT KLYRCF+ S A + + +FWN+V++RGL+S+N++ +QQ Sbjct: 535 MTRRRLMITVKLYRCFSTSDASENKVSLLFWNHVVDRGLMSRNSMNKIQQ 584 >ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Citrus sinensis] Length = 592 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQ 155 D M RRLMIT K+YR F+ASYA D I+ +FW++V++RGL+SK+ + MQ Sbjct: 538 DDMYRRRLMITLKIYRSFSASYAKDNEILDLFWSHVVDRGLMSKHIFKEMQ 588 >ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] gi|557532930|gb|ESR44113.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] Length = 592 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQ 155 D M RRLMIT K+YR F+ASYA D I+ +FW++V++RGL+SK+ + MQ Sbjct: 538 DDMYRRRLMITLKIYRSFSASYAKDNEILDLFWSHVVDRGLMSKHIFKEMQ 588 >ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Fragaria vesca subsp. vesca] Length = 589 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/53 (54%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNT-LRHMQQ 158 D M +RRLM+T K+YR FNASYA + +I+ +FWN+++ERGL+SK + MQQ Sbjct: 536 DEMFKRRLMVTRKIYRSFNASYASESDILCLFWNHMVERGLMSKTVMMTEMQQ 588 >ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] gi|571499072|ref|XP_006594396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X2 [Glycine max] gi|571499074|ref|XP_006594397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X3 [Glycine max] gi|571499076|ref|XP_006594398.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X4 [Glycine max] gi|571499078|ref|XP_006594399.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X5 [Glycine max] gi|571499080|ref|XP_006594400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X6 [Glycine max] Length = 587 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 M RRLMIT KLYRCF+ S A + + FWN+V++RGL+S+NT+ +QQ Sbjct: 535 MARRRLMITVKLYRCFSTSDAHENKVSQFFWNHVVDRGLMSRNTMYKIQQ 584 >gb|EXB85827.1| hypothetical protein L484_009673 [Morus notabilis] Length = 584 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQ 155 D M +RRLMIT K+YR FN SYA D NI+ +FW++++ER L+S++ L+ MQ Sbjct: 532 DEMYKRRLMITRKIYRSFNDSYATDDNIMRMFWDHMVERRLMSRSLLKEMQ 582 >ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] gi|449518107|ref|XP_004166085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] Length = 578 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 MT+R L+I KLYRCFNASY +I+ +FW++V ERGL+SK+ + +Q+ Sbjct: 529 MTKRSLLINLKLYRCFNASYGPHNSILHLFWDHVAERGLLSKSITKEIQK 578 >ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521881|gb|AET02335.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 731 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +3 Query: 9 MTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 M RRLMIT K+YRCF+A A + +FW++V+ERGL+S+NT+ +QQ Sbjct: 539 MARRRLMITVKIYRCFSALDASQNKVSQMFWDHVVERGLMSRNTMYKIQQ 588 >ref|NP_198689.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171307|sp|Q9FKR3.1|PP404_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g38730 gi|10176899|dbj|BAB10131.1| unnamed protein product [Arabidopsis thaliana] gi|332006971|gb|AED94354.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 596 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQPKL 167 DVM RRLM+ KLY+ +ASYAGD +++ FW++V +R LISK+ LR M + ++ Sbjct: 541 DVMYNRRLMVNLKLYKSISASYAGDNDVLRFFWSHVGDRCLISKSILREMNRSEV 595 >ref|XP_006405706.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum] gi|557106844|gb|ESQ47159.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum] Length = 619 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/55 (47%), Positives = 39/55 (70%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQPKL 167 D+M RRLM+ KLY+ +ASYAGD ++ FW++V +R LISK+ LR M + ++ Sbjct: 564 DIMYNRRLMVNLKLYKSLSASYAGDNEVLRFFWSHVGDRCLISKSILREMNRSEV 618 >ref|XP_006282941.1| hypothetical protein CARUB_v10007510mg [Capsella rubella] gi|482551646|gb|EOA15839.1| hypothetical protein CARUB_v10007510mg [Capsella rubella] Length = 606 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/52 (48%), Positives = 38/52 (73%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQQ 158 D M RR+M+ KLY+ +ASYAGDK+++ FW++V +R LISK+ L+ M + Sbjct: 541 DKMYNRRIMVNLKLYKSISASYAGDKDVLRFFWSHVGDRSLISKSILQEMNR 592 >ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Solanum lycopersicum] Length = 588 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVIERGLISKNTLRHMQ 155 D M +RRLMIT K+Y+ FNASY+ + ++ +FW+ V++RGLIS+ +Q Sbjct: 534 DDMYKRRLMITLKMYKSFNASYSDENTLLNMFWSNVVQRGLISRTVYDEIQ 584 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +3 Query: 3 DVMTERRLMITYKLYRCFNASYAGDKNIIGIFWNYVI 113 D M +RRLMIT K+YR NASYAGD +I+ +FWN+V+ Sbjct: 537 DEMYKRRLMITLKIYRALNASYAGDNSILSLFWNHVV 573