BLASTX nr result
ID: Paeonia22_contig00044258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044258 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officin... 58 3e-08 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 63 5e-08 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 63 5e-08 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 62 6e-08 ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 62 6e-08 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 60 3e-07 ref|XP_004289453.1| PREDICTED: uncharacterized protein LOC101306... 60 4e-07 >gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officinalis] Length = 176 Score = 58.2 bits (139), Expect(2) = 3e-08 Identities = 21/47 (44%), Positives = 40/47 (85%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 S+ + K+DFK+EI +Y+G++D E+LD W++R+ETYF+++ Y+ K+++ Sbjct: 103 SYQNLKIDFKVEILIYDGSVDVERLDDWIERMETYFTLYGYSSKEKI 149 Score = 25.4 bits (54), Expect(2) = 3e-08 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 142 IKFAS*KFDGHVLTW*MSYSK 204 I F + K GH LTW SY K Sbjct: 149 IVFTTLKLSGHALTWWKSYCK 169 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 S + K+DFK++IP+Y G +D EKLD WVD LETYF+V+KY+ Q++ Sbjct: 107 SIDTLKIDFKVDIPIYKGDIDPEKLDNWVDTLETYFTVYKYSNVQKI 153 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 S + K+DFK++IP+Y G +D EKLD WVD LETYF+V+KY+ Q++ Sbjct: 117 SIDTLKIDFKVDIPIYKGDIDPEKLDNWVDTLETYFTVYKYSNVQKI 163 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 S + K+DFK++IP+Y G +D EKLD WVD LETYF+V+KY+ Q++ Sbjct: 36 SIDTLKIDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKI 82 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 S + K+DFK++IP+Y G +D EKLD WVD LETYF+V+KY+ Q++ Sbjct: 107 SIDTLKIDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKI 153 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +2 Query: 23 MDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYTPKQEL 145 +DFK++IP+Y G +D EKLD WVD LETYF+V+KY+ Q++ Sbjct: 1 IDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKI 41 >ref|XP_004289453.1| PREDICTED: uncharacterized protein LOC101306573 [Fragaria vesca subsp. vesca] Length = 763 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/42 (52%), Positives = 37/42 (88%) Frame = +2 Query: 5 SFTSPKMDFKIEIPVYNGALDGEKLDTWVDRLETYFSVHKYT 130 SF + K+DFKIE+P+Y+G+++ +KLD W++RL+TYF+ H++T Sbjct: 78 SFRNLKIDFKIEVPMYDGSVNVDKLDDWIERLDTYFTFHRFT 119