BLASTX nr result
ID: Paeonia22_contig00044203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044203 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces gra... 87 3e-15 ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosp... 81 1e-13 ref|XP_001800835.1| hypothetical protein SNOG_10569 [Phaeosphaer... 80 3e-13 gb|EXJ83175.1| plasma membrane proteolipid 3 [Capronia coronata ... 79 7e-13 gb|EXJ69385.1| plasma membrane proteolipid 3 [Cladophialophora p... 79 7e-13 gb|EXJ54341.1| plasma membrane proteolipid 3 [Cladophialophora y... 79 7e-13 gb|ETN43714.1| plasma membrane proteolipid 3 [Cyphellophora euro... 79 7e-13 gb|ETI20570.1| plasma membrane proteolipid 3 [Cladophialophora c... 79 9e-13 gb|ENI09224.1| hypothetical protein COCC4DRAFT_68773 [Bipolaris ... 78 1e-12 gb|EMD90564.1| hypothetical protein COCHEDRAFT_1179511 [Bipolari... 78 1e-12 gb|EUC33038.1| hypothetical protein COCCADRAFT_5327 [Bipolaris z... 78 1e-12 gb|EMS19696.1| stress response RCI peptide, putative [Rhodospori... 78 1e-12 gb|EMD58860.1| hypothetical protein COCSADRAFT_176105 [Bipolaris... 78 1e-12 ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] ... 78 1e-12 ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI... 77 3e-12 ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsi... 77 3e-12 gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxyspor... 76 4e-12 ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melam... 76 4e-12 gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderm... 76 6e-12 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 76 6e-12 >gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +1 Query: 67 NKSSRPNNHTTANMPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 +K ++P+ T ANMPFTASDICKI+LA+ILPPLGVFLERGC AD LINILLT Sbjct: 14 HKQTQPDTDTPANMPFTASDICKIILAVILPPLGVFLERGCGADLLINILLT 65 >ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] gi|312218894|emb|CBX98839.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] Length = 131 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 39 >ref|XP_001800835.1| hypothetical protein SNOG_10569 [Phaeosphaeria nodorum SN15] gi|111060843|gb|EAT81963.1| hypothetical protein SNOG_10569 [Phaeosphaeria nodorum SN15] Length = 57 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGCNADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCNADFLINILLT 39 >gb|EXJ83175.1| plasma membrane proteolipid 3 [Capronia coronata CBS 617.96] Length = 64 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGCNADF INILLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLT 39 >gb|EXJ69385.1| plasma membrane proteolipid 3 [Cladophialophora psammophila CBS 110553] Length = 57 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGCNADF INILLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLT 39 >gb|EXJ54341.1| plasma membrane proteolipid 3 [Cladophialophora yegresii CBS 114405] Length = 79 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGCNADF INILLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLT 39 >gb|ETN43714.1| plasma membrane proteolipid 3 [Cyphellophora europaea CBS 101466] Length = 51 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGCNADF INILLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLT 39 >gb|ETI20570.1| plasma membrane proteolipid 3 [Cladophialophora carrionii CBS 160.54] Length = 79 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAI+LPPLGVFLERGCNADF INILLT Sbjct: 1 MPFTASDICKIILAIVLPPLGVFLERGCNADFFINILLT 39 >gb|ENI09224.1| hypothetical protein COCC4DRAFT_68773 [Bipolaris maydis ATCC 48331] Length = 415 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADFLINILLT 39 >gb|EMD90564.1| hypothetical protein COCHEDRAFT_1179511 [Bipolaris maydis C5] Length = 415 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADFLINILLT 39 >gb|EUC33038.1| hypothetical protein COCCADRAFT_5327 [Bipolaris zeicola 26-R-13] gi|576932050|gb|EUC45599.1| hypothetical protein COCMIDRAFT_5223 [Bipolaris oryzae ATCC 44560] gi|578484591|gb|EUN22110.1| hypothetical protein COCVIDRAFT_30797 [Bipolaris victoriae FI3] Length = 57 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLT 39 >gb|EMS19696.1| stress response RCI peptide, putative [Rhodosporidium toruloides NP11] Length = 57 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGCNADF IN+LLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFWINVLLT 39 >gb|EMD58860.1| hypothetical protein COCSADRAFT_176105 [Bipolaris sorokiniana ND90Pr] Length = 414 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLT 39 >ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] gi|340515326|gb|EGR45581.1| predicted protein [Trichoderma reesei QM6a] gi|572275412|gb|ETR98847.1| UPF0057-domain-containing protein [Trichoderma reesei RUT C-30] Length = 57 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLT 39 >ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256731818|gb|EEU45167.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 57 Score = 77.0 bits (188), Expect = 3e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPP+GVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFLINILLT 39 >ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586744|emb|CAP94391.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|584409824|emb|CDM33848.1| Plasma membrane proteolipid 3 [Penicillium roqueforti] Length = 57 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+ AIILPPLGVFLERGC ADFLINILLT Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADFLINILLT 39 >gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176] gi|517317170|emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289] gi|584131311|gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600] gi|587668050|gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a] gi|587690392|gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47] gi|587719003|gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746858|gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037174|gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 26406] gi|590063000|gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 54005] gi|591421327|gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452771|gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470692|gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503744|gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 57 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC ADF INILLT Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFFINILLT 39 >ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] gi|328859168|gb|EGG08278.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] Length = 57 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAI+LPPLGVFLERGC ADF INILLT Sbjct: 1 MPFTASDICKILLAIVLPPLGVFLERGCGADFWINILLT 39 >gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderma virens Gv29-8] Length = 57 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKILLAIILPP+GVFLERGC AD LINILLT Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADLLINILLT 39 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 106 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLT 222 MPFTASDICKI+LAIILPPLGVFLERGC AD LINILLT Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCGADLLINILLT 39