BLASTX nr result
ID: Paeonia22_contig00044140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044140 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004514129.1| PREDICTED: probable S-acyltransferase At3g09... 56 5e-06 >ref|XP_004514129.1| PREDICTED: probable S-acyltransferase At3g09320-like isoform X1 [Cicer arietinum] Length = 291 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +2 Query: 2 PNILGWVFPTSKHIGSGLRFRTAYDKTTGVSTPK 103 PNIL W++PT+ HIGSGLRFRT YD T G ST K Sbjct: 258 PNILSWLWPTANHIGSGLRFRTVYDLTKGASTSK 291