BLASTX nr result
ID: Paeonia22_contig00043919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043919 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528689.1| pentatricopeptide repeat-containing protein,... 65 1e-08 >ref|XP_002528689.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531861|gb|EEF33678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 271 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/73 (50%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = -2 Query: 220 NKIGIDLIEKNDGLPIKEE-QEILDCTKKNSRLRVQNYVDRIRALPTSERIKILDIFEEK 44 +K GI L+EK++GL IKE+ QE + K SRL+V+ +D IRALP R +ILD+F + Sbjct: 22 HKQGISLVEKHNGLRIKEQKQESVKFDAKASRLQVEKLLDAIRALPFKGRTEILDVFGKD 81 Query: 43 IGFQNISDFNDLL 5 +ISDFNDLL Sbjct: 82 GEIPSISDFNDLL 94