BLASTX nr result
ID: Paeonia22_contig00043897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043897 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428566.1| hypothetical protein CICLE_v10013387mg, part... 55 8e-06 >ref|XP_006428566.1| hypothetical protein CICLE_v10013387mg, partial [Citrus clementina] gi|557530623|gb|ESR41806.1| hypothetical protein CICLE_v10013387mg, partial [Citrus clementina] Length = 204 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = -3 Query: 193 GCSTAEVMKLLRSIPGCEPRSPLFFLGTRLFKDKENRAMFVALEN*ETML*WLK 32 GCS AEVM++L S+P E +S L+ T++F KENR MF A++N + + WLK Sbjct: 145 GCSIAEVMEVLYSMPEIEIKSELYLNATKIFLKKENREMFAAIKNRDAQIEWLK 198