BLASTX nr result
ID: Paeonia22_contig00043697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043697 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007289066.1| 4 family polyadenylate binding protein [Mars... 86 5e-15 emb|CCU76868.1| putative polyadenylate-binding protein [Blumeria... 85 9e-15 gb|EPQ66405.1| Poly(A) binding protein [Blumeria graminis f. sp.... 85 9e-15 gb|ESZ93443.1| putative Polyadenylate-binding protein, cytoplasm... 83 5e-14 gb|EMR90764.1| putative polyadenylate-binding protein [Botryotin... 83 5e-14 ref|XP_001598277.1| hypothetical protein SS1G_00363 [Sclerotinia... 83 5e-14 ref|XP_001560741.1| hypothetical protein BC1G_00769 [Botryotinia... 83 5e-14 gb|EHL00002.1| putative Polyadenylate-binding protein, cytoplasm... 81 2e-13 gb|EOO03737.1| putative polyadenylate-binding protein [Togninia ... 79 9e-13 gb|EFZ02640.1| poly(A) RNA binding protein [Metarhizium anisopli... 77 2e-12 gb|EFY90490.1| poly(A) RNA binding protein [Metarhizium acridum ... 77 2e-12 gb|EZF28640.1| polyadenylate-binding protein, cytoplasmic and nu... 77 2e-12 gb|EGE02140.1| polyadenylate-binding protein [Trichophyton equin... 77 2e-12 gb|EGD98532.1| polyadenylate-binding protein [Trichophyton tonsu... 77 2e-12 ref|XP_003234302.1| polyadenylate-binding protein [Trichophyton ... 77 2e-12 ref|XP_003175547.1| hypothetical protein MGYG_03072 [Arthroderma... 77 2e-12 ref|XP_003020804.1| hypothetical protein TRV_05080 [Trichophyton... 77 2e-12 ref|XP_003012489.1| hypothetical protein ARB_01449 [Arthroderma ... 77 2e-12 ref|XP_002847958.1| polyadenylate-binding protein [Arthroderma o... 77 2e-12 gb|ETS77879.1| Polyadenylate-binding protein [Pestalotiopsis fic... 77 3e-12 >ref|XP_007289066.1| 4 family polyadenylate binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867457|gb|EKD20495.1| 4 family polyadenylate binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 785 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKNN 176 AGKITGMLLEMENQELVNLIEDD+ALR+KVDEALTVYDEYVKNN Sbjct: 722 AGKITGMLLEMENQELVNLIEDDSALRSKVDEALTVYDEYVKNN 765 >emb|CCU76868.1| putative polyadenylate-binding protein [Blumeria graminis f. sp. hordei DH14] Length = 771 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKNN 176 AGKITGMLLEMENQELVNLIED+TALRAKV+EALTVYDEYVKNN Sbjct: 710 AGKITGMLLEMENQELVNLIEDNTALRAKVEEALTVYDEYVKNN 753 >gb|EPQ66405.1| Poly(A) binding protein [Blumeria graminis f. sp. tritici 96224] Length = 771 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKNN 176 AGKITGMLLEMENQELVNLIED+TALRAKV+EALTVYDEYVKNN Sbjct: 710 AGKITGMLLEMENQELVNLIEDNTALRAKVEEALTVYDEYVKNN 753 >gb|ESZ93443.1| putative Polyadenylate-binding protein, cytoplasmic and nuclear [Sclerotinia borealis F-4157] Length = 796 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMENQEL+NLIEDD +LRAKVDEALTVYDEYVKN Sbjct: 730 AGKITGMLLEMENQELINLIEDDASLRAKVDEALTVYDEYVKN 772 >gb|EMR90764.1| putative polyadenylate-binding protein [Botryotinia fuckeliana BcDW1] Length = 793 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMENQEL+NLIEDD +LRAKVDEALTVYDEYVKN Sbjct: 729 AGKITGMLLEMENQELINLIEDDASLRAKVDEALTVYDEYVKN 771 >ref|XP_001598277.1| hypothetical protein SS1G_00363 [Sclerotinia sclerotiorum 1980] gi|154691225|gb|EDN90963.1| hypothetical protein SS1G_00363 [Sclerotinia sclerotiorum 1980 UF-70] Length = 784 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMENQEL+NLIEDD +LRAKVDEALTVYDEYVKN Sbjct: 720 AGKITGMLLEMENQELINLIEDDASLRAKVDEALTVYDEYVKN 762 >ref|XP_001560741.1| hypothetical protein BC1G_00769 [Botryotinia fuckeliana B05.10] gi|347837080|emb|CCD51652.1| similar to polyadenylate-binding protein [Botryotinia fuckeliana T4] Length = 790 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMENQEL+NLIEDD +LRAKVDEALTVYDEYVKN Sbjct: 726 AGKITGMLLEMENQELINLIEDDASLRAKVDEALTVYDEYVKN 768 >gb|EHL00002.1| putative Polyadenylate-binding protein, cytoplasmic and nuclear [Glarea lozoyensis 74030] gi|512205784|gb|EPE34605.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] Length = 783 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKNN 176 AGKITGMLLEMEN ELVNLIED++ALR KVDEALTVYDEYVKNN Sbjct: 719 AGKITGMLLEMENPELVNLIEDESALRNKVDEALTVYDEYVKNN 762 >gb|EOO03737.1| putative polyadenylate-binding protein [Togninia minima UCRPA7] Length = 775 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVK 182 AGKITGMLLEMENQEL+NLIEDDTALR KVDEA+ VYDEYVK Sbjct: 716 AGKITGMLLEMENQELINLIEDDTALRNKVDEAMAVYDEYVK 757 >gb|EFZ02640.1| poly(A) RNA binding protein [Metarhizium anisopliae ARSEF 23] gi|594722968|gb|EXV05854.1| polyadenylate binding protein [Metarhizium robertsii] Length = 743 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMEN ELVNLIEDD AL+AKVDEAL VYDEYVK+ Sbjct: 682 AGKITGMLLEMENSELVNLIEDDVALKAKVDEALAVYDEYVKS 724 >gb|EFY90490.1| poly(A) RNA binding protein [Metarhizium acridum CQMa 102] Length = 742 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEMEN ELVNLIEDD AL+AKVDEAL VYDEYVK+ Sbjct: 681 AGKITGMLLEMENSELVNLIEDDVALKAKVDEALAVYDEYVKS 723 >gb|EZF28640.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton interdigitale H6] Length = 782 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 717 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 759 >gb|EGE02140.1| polyadenylate-binding protein [Trichophyton equinum CBS 127.97] Length = 782 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 717 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 759 >gb|EGD98532.1| polyadenylate-binding protein [Trichophyton tonsurans CBS 112818] Length = 676 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 611 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 653 >ref|XP_003234302.1| polyadenylate-binding protein [Trichophyton rubrum CBS 118892] gi|326463196|gb|EGD88649.1| polyadenylate-binding protein [Trichophyton rubrum CBS 118892] gi|607878764|gb|EZF23787.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum MR850] gi|607905532|gb|EZF42853.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum CBS 100081] gi|607917612|gb|EZF53482.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum CBS 288.86] gi|607929664|gb|EZF64100.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum CBS 289.86] gi|607941559|gb|EZF74704.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton soudanense CBS 452.61] gi|607953669|gb|EZF85395.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum MR1448] gi|607965870|gb|EZF96151.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum MR1459] gi|607978173|gb|EZG07270.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum CBS 735.88] gi|607989996|gb|EZG17865.1| polyadenylate-binding protein, cytoplasmic and nuclear [Trichophyton rubrum CBS 202.88] Length = 781 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 716 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 758 >ref|XP_003175547.1| hypothetical protein MGYG_03072 [Arthroderma gypseum CBS 118893] gi|311340862|gb|EFR00065.1| hypothetical protein MGYG_03072 [Arthroderma gypseum CBS 118893] Length = 782 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 717 AGKITGMLLEMDNSELIGLVDDDAALRAKVDEALTVYDEYVKN 759 >ref|XP_003020804.1| hypothetical protein TRV_05080 [Trichophyton verrucosum HKI 0517] gi|291184669|gb|EFE40186.1| hypothetical protein TRV_05080 [Trichophyton verrucosum HKI 0517] Length = 816 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 751 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 793 >ref|XP_003012489.1| hypothetical protein ARB_01449 [Arthroderma benhamiae CBS 112371] gi|291176047|gb|EFE31849.1| hypothetical protein ARB_01449 [Arthroderma benhamiae CBS 112371] Length = 801 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 736 AGKITGMLLEMDNSELIGLVDDDVALRAKVDEALTVYDEYVKN 778 >ref|XP_002847958.1| polyadenylate-binding protein [Arthroderma otae CBS 113480] gi|238840983|gb|EEQ30645.1| polyadenylate-binding protein [Arthroderma otae CBS 113480] Length = 708 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N EL+ L++DD ALRAKVDEALTVYDEYVKN Sbjct: 643 AGKITGMLLEMDNSELIGLVDDDAALRAKVDEALTVYDEYVKN 685 >gb|ETS77879.1| Polyadenylate-binding protein [Pestalotiopsis fici W106-1] Length = 763 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 307 AGKITGMLLEMENQELVNLIEDDTALRAKVDEALTVYDEYVKN 179 AGKITGMLLEM+N ELVNLIEDD ALRAKVDEA+ VYDEYVK+ Sbjct: 701 AGKITGMLLEMDNNELVNLIEDDAALRAKVDEAMAVYDEYVKS 743