BLASTX nr result
ID: Paeonia22_contig00043685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043685 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37540.3| unnamed protein product [Vitis vinifera] 47 9e-09 ref|XP_007214351.1| hypothetical protein PRUPE_ppa000071mg [Prun... 41 2e-07 ref|XP_006580336.1| PREDICTED: callose synthase 5-like [Glycine ... 41 2e-07 ref|XP_003630264.1| Callose synthase [Medicago truncatula] gi|35... 39 2e-06 emb|CAN80181.1| hypothetical protein VITISV_008958 [Vitis vinifera] 47 6e-06 gb|ACV04900.1| callose synthase 5 [Arabidopsis thaliana] 39 7e-06 >emb|CBI37540.3| unnamed protein product [Vitis vinifera] Length = 1958 Score = 47.0 bits (110), Expect(3) = 9e-09 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 VK V LWNT GLNWPT F HR+KAG+L Sbjct: 206 VKAAVGALWNTRGLNWPTEFERHRQKAGDL 235 Score = 33.1 bits (74), Expect(3) = 9e-09 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +3 Query: 330 RNQRKHLILLLANNH 374 RNQR+HLILLLANNH Sbjct: 253 RNQREHLILLLANNH 267 Score = 24.3 bits (51), Expect(3) = 9e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 197 LLD*LRVMFGFQA 235 LLD LR MFGFQA Sbjct: 237 LLDWLRAMFGFQA 249 >ref|XP_007214351.1| hypothetical protein PRUPE_ppa000071mg [Prunus persica] gi|462410216|gb|EMJ15550.1| hypothetical protein PRUPE_ppa000071mg [Prunus persica] Length = 1965 Score = 40.8 bits (94), Expect(3) = 2e-07 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 VK V LWNT GLNWP+AF R+KAG+L Sbjct: 207 VKAAVGALWNTRGLNWPSAF-ESRQKAGDL 235 Score = 34.3 bits (77), Expect(3) = 2e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 330 RNQRKHLILLLANNHIR 380 RNQR+HLILLLAN HIR Sbjct: 253 RNQREHLILLLANTHIR 269 Score = 24.3 bits (51), Expect(3) = 2e-07 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 197 LLD*LRVMFGFQA 235 LLD LR MFGFQA Sbjct: 237 LLDWLRAMFGFQA 249 >ref|XP_006580336.1| PREDICTED: callose synthase 5-like [Glycine max] Length = 1937 Score = 41.2 bits (95), Expect(3) = 2e-07 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 +K V+ LWNT GLNWP +F R+K G+L Sbjct: 204 IKAAVSALWNTRGLNWPNSFEQQRQKTGDL 233 Score = 36.2 bits (82), Expect(3) = 2e-07 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 321 DKSRNQRKHLILLLANNHIR 380 D RNQR+HLILLLAN+HIR Sbjct: 248 DSVRNQREHLILLLANSHIR 267 Score = 21.9 bits (45), Expect(3) = 2e-07 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 197 LLD*LRVMFGFQ 232 +LD LR MFGFQ Sbjct: 235 MLDWLRAMFGFQ 246 >ref|XP_003630264.1| Callose synthase [Medicago truncatula] gi|355524286|gb|AET04740.1| Callose synthase [Medicago truncatula] Length = 2044 Score = 39.3 bits (90), Expect(3) = 2e-06 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 +K V+ LWNT GLNWP +F R++ G+L Sbjct: 220 IKAAVSALWNTRGLNWPGSFEQQRQRTGDL 249 Score = 36.2 bits (82), Expect(3) = 2e-06 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 321 DKSRNQRKHLILLLANNHIR 380 D RNQR+HLILLLAN+HIR Sbjct: 264 DSVRNQREHLILLLANSHIR 283 Score = 20.4 bits (41), Expect(3) = 2e-06 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 197 LLD*LRVMFGFQ 232 +LD LR +FGFQ Sbjct: 251 MLDWLRAIFGFQ 262 >emb|CAN80181.1| hypothetical protein VITISV_008958 [Vitis vinifera] Length = 1933 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 VK V LWNT GLNWPT F HR+KAG+L Sbjct: 198 VKAAVGALWNTRGLNWPTEFERHRQKAGDL 227 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +2 Query: 197 LLD*LRVMFGFQACVIYLKDNMLTTYYHYI 286 LLD LR MFGFQAC +DN+ H I Sbjct: 229 LLDWLRAMFGFQACG---RDNVRNQREHLI 255 >gb|ACV04900.1| callose synthase 5 [Arabidopsis thaliana] Length = 1923 Score = 39.3 bits (90), Expect(3) = 7e-06 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = +1 Query: 103 VKVVVNTLWNTHGLNWPTAF**HRKKAGEL 192 VK V L NT GLNWP+ F HRKK G L Sbjct: 209 VKAAVAALGNTRGLNWPSGFEQHRKKTGNL 238 Score = 30.8 bits (68), Expect(3) = 7e-06 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +3 Query: 330 RNQRKHLILLLANNHIR 380 RNQR+HL+ L A+NHIR Sbjct: 256 RNQREHLVCLFADNHIR 272 Score = 24.3 bits (51), Expect(3) = 7e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 197 LLD*LRVMFGFQA 235 LLD LR MFGFQA Sbjct: 240 LLDWLRAMFGFQA 252