BLASTX nr result
ID: Paeonia22_contig00043234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043234 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHL02143.1| putative Fatty acid synthase subunit alpha [Glare... 72 8e-11 gb|EXL94283.1| fatty acid synthase subunit alpha [Fusarium oxysp... 64 3e-08 gb|EXK35261.1| fatty acid synthase subunit alpha [Fusarium oxysp... 64 3e-08 gb|EXJ80844.1| fatty acid synthase subunit alpha [Capronia epimy... 64 3e-08 gb|EXJ66726.1| fatty acid synthase subunit alpha [Cladophialopho... 64 3e-08 gb|EXJ58491.1| fatty acid synthase subunit alpha [Cladophialopho... 64 3e-08 ref|XP_007598638.1| hypothetical protein CFIO01_03119 [Colletotr... 64 3e-08 gb|EWZ42123.1| fatty acid synthase subunit alpha [Fusarium oxysp... 64 3e-08 emb|CDM34932.1| Fatty acid synthase subunit alpha [Penicillium r... 64 3e-08 gb|EWG42433.1| fatty acid synthase subunit alpha [Fusarium verti... 64 3e-08 ref|XP_001223165.1| conserved hypothetical protein [Chaetomium g... 64 3e-08 ref|XP_385497.1| hypothetical protein FG05321.1 [Fusarium gramin... 64 3e-08 gb|ETS82808.1| Fatty acid synthase subunit alpha [Pestalotiopsis... 64 3e-08 gb|ETI23348.1| fatty acid synthase subunit alpha [Cladophialopho... 64 3e-08 gb|ESZ94205.1| fatty acid synthase subunit alpha [Sclerotinia bo... 64 3e-08 dbj|GAD95796.1| hypothetical protein CIMG_08477, partial [Byssoc... 64 3e-08 gb|ERT02538.1| fatty acid synthase subunit alpha [Sporothrix sch... 64 3e-08 emb|CCT64239.1| probable fatty acid synthase, alpha subunit [Fus... 64 3e-08 gb|EQL31008.1| fatty acid synthase subunit alpha [Ajellomyces de... 64 3e-08 gb|EQB55281.1| hypothetical protein CGLO_04814 [Colletotrichum g... 64 3e-08 >gb|EHL02143.1| putative Fatty acid synthase subunit alpha [Glarea lozoyensis 74030] Length = 2225 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/47 (78%), Positives = 39/47 (82%) Frame = -3 Query: 143 YPSKTSLDVCGR*STCTMRPEVEQELAHTLLVELLAYQFASPVRWIE 3 YPS+ L V GR + MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 80 YPSEYFLIVPGRKTKVEMRPEVEQELAHTLLVELLAYQFASPVRWIE 126 >gb|EXL94283.1| fatty acid synthase subunit alpha [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 1855 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EXK35261.1| fatty acid synthase subunit alpha [Fusarium oxysporum f. sp. melonis 26406] Length = 1856 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EXJ80844.1| fatty acid synthase subunit alpha [Capronia epimyces CBS 606.96] Length = 1866 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EXJ66726.1| fatty acid synthase subunit alpha [Cladophialophora psammophila CBS 110553] Length = 1866 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EXJ58491.1| fatty acid synthase subunit alpha [Cladophialophora yegresii CBS 114405] Length = 1866 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >ref|XP_007598638.1| hypothetical protein CFIO01_03119 [Colletotrichum fioriniae PJ7] gi|588896301|gb|EXF77798.1| hypothetical protein CFIO01_03119 [Colletotrichum fioriniae PJ7] Length = 1856 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EWZ42123.1| fatty acid synthase subunit alpha [Fusarium oxysporum Fo47] Length = 1855 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >emb|CDM34932.1| Fatty acid synthase subunit alpha [Penicillium roqueforti] Length = 1852 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EWG42433.1| fatty acid synthase subunit alpha [Fusarium verticillioides 7600] Length = 1855 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >ref|XP_001223165.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] gi|88179864|gb|EAQ87332.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] Length = 1513 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >ref|XP_385497.1| hypothetical protein FG05321.1 [Fusarium graminearum PH-1] gi|558861177|gb|ESU11260.1| fatty acid synthase subunit alpha reductase [Fusarium graminearum PH-1] gi|596550512|gb|EYB30065.1| hypothetical protein FG05_05321 [Fusarium graminearum] Length = 1856 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|ETS82808.1| Fatty acid synthase subunit alpha [Pestalotiopsis fici W106-1] Length = 1863 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|ETI23348.1| fatty acid synthase subunit alpha [Cladophialophora carrionii CBS 160.54] Length = 1865 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|ESZ94205.1| fatty acid synthase subunit alpha [Sclerotinia borealis F-4157] Length = 1865 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >dbj|GAD95796.1| hypothetical protein CIMG_08477, partial [Byssochlamys spectabilis No. 5] Length = 108 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|ERT02538.1| fatty acid synthase subunit alpha [Sporothrix schenckii ATCC 58251] Length = 1864 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >emb|CCT64239.1| probable fatty acid synthase, alpha subunit [Fusarium fujikuroi IMI 58289] Length = 1855 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EQL31008.1| fatty acid synthase subunit alpha [Ajellomyces dermatitidis ATCC 26199] Length = 1900 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30 >gb|EQB55281.1| hypothetical protein CGLO_04814 [Colletotrichum gloeosporioides Cg-14] Length = 1861 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 92 MRPEVEQELAHTLLVELLAYQFASPVRWIE 3 MRPEVEQELAHTLLVELLAYQFASPVRWIE Sbjct: 1 MRPEVEQELAHTLLVELLAYQFASPVRWIE 30