BLASTX nr result
ID: Paeonia22_contig00043173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043173 (628 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33174.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_002282289.1| PREDICTED: 60S ribosomal protein L35-like [V... 57 4e-06 ref|XP_006366921.1| PREDICTED: 60S ribosomal protein L35-like [S... 57 6e-06 ref|XP_007150275.1| hypothetical protein PHAVU_005G140200g [Phas... 57 6e-06 ref|XP_007142699.1| hypothetical protein PHAVU_007G009400g [Phas... 57 6e-06 ref|XP_004505904.1| PREDICTED: 60S ribosomal protein L35-like [C... 57 6e-06 ref|XP_004497317.1| PREDICTED: 60S ribosomal protein L35-like [C... 57 6e-06 ref|XP_004494985.1| PREDICTED: 60S ribosomal protein L35-like [C... 57 6e-06 gb|AAZ32938.1| putative 60S ribosomal protein L35 [Rheum australe] 57 6e-06 gb|AFK47959.1| unknown [Medicago truncatula] 57 6e-06 gb|AFK46795.1| unknown [Medicago truncatula] 57 6e-06 gb|AFK40432.1| unknown [Lotus japonicus] 57 6e-06 gb|AFK34682.1| unknown [Lotus japonicus] gi|388505778|gb|AFK4095... 57 6e-06 gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] 57 6e-06 ref|NP_001235057.1| uncharacterized protein LOC100305671 [Glycin... 57 6e-06 ref|XP_007144483.1| hypothetical protein PHAVU_007G159800g [Phas... 56 8e-06 ref|XP_002962706.1| hypothetical protein SELMODRAFT_79331 [Selag... 56 8e-06 ref|XP_002962704.1| hypothetical protein SELMODRAFT_438324 [Sela... 56 8e-06 >emb|CBI33174.3| unnamed protein product [Vitis vinifera] Length = 174 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQV 548 KNKKYLPLDLRPKKTRAIR+RLTKHQV Sbjct: 125 KNKKYLPLDLRPKKTRAIRKRLTKHQV 151 >ref|XP_002282289.1| PREDICTED: 60S ribosomal protein L35-like [Vitis vinifera] Length = 123 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQV 548 KNKKYLPLDLRPKKTRAIR+RLTKHQV Sbjct: 74 KNKKYLPLDLRPKKTRAIRKRLTKHQV 100 >ref|XP_006366921.1| PREDICTED: 60S ribosomal protein L35-like [Solanum tuberosum] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_007150275.1| hypothetical protein PHAVU_005G140200g [Phaseolus vulgaris] gi|561023539|gb|ESW22269.1| hypothetical protein PHAVU_005G140200g [Phaseolus vulgaris] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_007142699.1| hypothetical protein PHAVU_007G009400g [Phaseolus vulgaris] gi|561015889|gb|ESW14693.1| hypothetical protein PHAVU_007G009400g [Phaseolus vulgaris] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_004505904.1| PREDICTED: 60S ribosomal protein L35-like [Cicer arietinum] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_004497317.1| PREDICTED: 60S ribosomal protein L35-like [Cicer arietinum] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_004494985.1| PREDICTED: 60S ribosomal protein L35-like [Cicer arietinum] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|AAZ32938.1| putative 60S ribosomal protein L35 [Rheum australe] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|AFK47959.1| unknown [Medicago truncatula] Length = 122 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 73 KNKKYLPLDLRPKKTRAIRRRLTKHQ 98 >gb|AFK46795.1| unknown [Medicago truncatula] Length = 121 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 72 KNKKYLPLDLRPKKTRAIRRRLTKHQ 97 >gb|AFK40432.1| unknown [Lotus japonicus] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|AFK34682.1| unknown [Lotus japonicus] gi|388505778|gb|AFK40955.1| unknown [Lotus japonicus] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|NP_001235057.1| uncharacterized protein LOC100305671 [Glycine max] gi|356576851|ref|XP_003556543.1| PREDICTED: 60S ribosomal protein L35-like [Glycine max] gi|255626269|gb|ACU13479.1| unknown [Glycine max] Length = 123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQ 551 KNKKYLPLDLRPKKTRAIRRRLTKHQ Sbjct: 74 KNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|XP_007144483.1| hypothetical protein PHAVU_007G159800g [Phaseolus vulgaris] gi|561017673|gb|ESW16477.1| hypothetical protein PHAVU_007G159800g [Phaseolus vulgaris] Length = 110 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQVLAFFF 533 K KKYLPLDLRPKKTRAIRRRLTK+QV F F Sbjct: 74 KTKKYLPLDLRPKKTRAIRRRLTKNQVSFFLF 105 >ref|XP_002962706.1| hypothetical protein SELMODRAFT_79331 [Selaginella moellendorffii] gi|300169567|gb|EFJ36169.1| hypothetical protein SELMODRAFT_79331 [Selaginella moellendorffii] Length = 121 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQV 548 KNKKY+PLDLRPKKTRAIRRRLTKHQ+ Sbjct: 72 KNKKYMPLDLRPKKTRAIRRRLTKHQL 98 >ref|XP_002962704.1| hypothetical protein SELMODRAFT_438324 [Selaginella moellendorffii] gi|302797254|ref|XP_002980388.1| hypothetical protein SELMODRAFT_419864 [Selaginella moellendorffii] gi|300152004|gb|EFJ18648.1| hypothetical protein SELMODRAFT_419864 [Selaginella moellendorffii] gi|300169565|gb|EFJ36167.1| hypothetical protein SELMODRAFT_438324 [Selaginella moellendorffii] Length = 123 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 628 KNKKYLPLDLRPKKTRAIRRRLTKHQV 548 KNKKY+PLDLRPKKTRAIRRRLTKHQ+ Sbjct: 74 KNKKYMPLDLRPKKTRAIRRRLTKHQL 100