BLASTX nr result
ID: Paeonia22_contig00043144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043144 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249... 51 8e-06 >ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249192 [Vitis vinifera] gi|296082953|emb|CBI22254.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 50.8 bits (120), Expect(2) = 8e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +1 Query: 64 ESAQKGQMEMKISFVLLFMISLVSEDVLPGVAESMLQRLVEDIKH 198 +S KGQ+EM ISFVL +++LV ED L VAES+L+RL+E++KH Sbjct: 185 QSRLKGQLEMSISFVLPPVLALVPEDGLRSVAESVLKRLLENMKH 229 Score = 24.3 bits (51), Expect(2) = 8e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +3 Query: 3 PSHFTLGVKG 32 PSHF+LGVKG Sbjct: 166 PSHFSLGVKG 175