BLASTX nr result
ID: Paeonia22_contig00043106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043106 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30521.3| unnamed protein product [Vitis vinifera] 59 7e-07 >emb|CBI30521.3| unnamed protein product [Vitis vinifera] Length = 943 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = -3 Query: 274 MINTEQPLKVYKKVRYGDYLRQSMKMQLEGKAHTKM 167 +++++QP+K+YKKVRYGDYLR SMK ++EGK HT+M Sbjct: 567 LVDSQQPIKIYKKVRYGDYLRHSMKRKMEGKFHTEM 602