BLASTX nr result
ID: Paeonia22_contig00043068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00043068 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533480.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 >ref|XP_002533480.1| conserved hypothetical protein [Ricinus communis] gi|223526673|gb|EEF28912.1| conserved hypothetical protein [Ricinus communis] Length = 65 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = -2 Query: 225 MNVQSVLVFCSSIPLVNCVLVPLILHFSSSEPAISKKSTPEEEKDEVAILLNRAAQNHFR 46 MN++ V V CSS+PL+ CV+ L+L F+S EP+ S + ++ A+ NRAAQ HFR Sbjct: 1 MNLRQVTVVCSSLPLLGCVVASLLLLFTSDEPSSSDSGSMVNDE---AVSNNRAAQKHFR 57 Query: 45 QLQNIRGA 22 Q+Q IRGA Sbjct: 58 QIQQIRGA 65