BLASTX nr result
ID: Paeonia22_contig00042717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042717 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521903.1| serine/threonine-protein kinase bri1, putati... 57 3e-06 >ref|XP_002521903.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223538941|gb|EEF40539.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 1140 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 206 ASEQDGLPTIKSDAEALVMLKKVIQKDPNGVLSGWEMSRDP 328 A+EQD +IK+DA AL+M KK+IQKDPNGVLSGW+++ P Sbjct: 31 AAEQDVGTSIKTDAAALLMFKKMIQKDPNGVLSGWKLNSSP 71