BLASTX nr result
ID: Paeonia22_contig00042695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042695 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217324.1| hypothetical protein PRUPE_ppa020181mg [Prun... 59 7e-07 >ref|XP_007217324.1| hypothetical protein PRUPE_ppa020181mg [Prunus persica] gi|462413474|gb|EMJ18523.1| hypothetical protein PRUPE_ppa020181mg [Prunus persica] Length = 244 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 226 AEFLVSFAGIHDTIHQFAAHQRFRKGPVSLPVKAL 122 AEFLV+F GI D IHQFA +QRF+KGPV+LPVKAL Sbjct: 207 AEFLVAFEGIQDAIHQFATNQRFQKGPVTLPVKAL 241