BLASTX nr result
ID: Paeonia22_contig00042639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042639 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF19226.1|AC007505_2 Highly similar to Ta1-3 polyprotein [Ar... 40 4e-06 >gb|AAF19226.1|AC007505_2 Highly similar to Ta1-3 polyprotein [Arabidopsis thaliana] Length = 1356 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 7/53 (13%) Frame = +2 Query: 182 GIFQEHVGIMSDSQSVINLGKDEAH-------DVFFHFVRKIIEDGDISLLKV 319 G+ Q+ V I DSQS I L K+ + DV F+++R ++E GD+ +LK+ Sbjct: 1272 GMQQDKVKIWCDSQSAICLSKNSVYHERTKHIDVRFNYIRDVVESGDVDVLKI 1324 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 24 IRAYMFTFACGLVSQRSALQSIVAFSTIEAENMVIAEA 137 I Y+FT VS +++LQ +VA ST EAE + +AEA Sbjct: 1220 ISGYVFTIGGNTVSWKASLQPVVAMSTTEAEYIALAEA 1257