BLASTX nr result
ID: Paeonia22_contig00042600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042600 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468073.1| PREDICTED: pentatricopeptide repeat-containi... 166 3e-39 ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containi... 163 2e-38 ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, part... 162 6e-38 ref|XP_007041101.1| Tetratricopeptide repeat (TPR)-like superfam... 161 8e-38 ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containi... 161 1e-37 emb|CAN67095.1| hypothetical protein VITISV_016806 [Vitis vinifera] 161 1e-37 ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containi... 160 2e-37 ref|XP_003541672.2| PREDICTED: pentatricopeptide repeat-containi... 159 3e-37 ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phas... 159 3e-37 ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 159 4e-37 ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containi... 159 4e-37 ref|XP_004295634.1| PREDICTED: pentatricopeptide repeat-containi... 158 6e-37 ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containi... 158 6e-37 ref|XP_006413827.1| hypothetical protein EUTSA_v10027143mg [Eutr... 157 2e-36 ref|XP_002869909.1| binding protein [Arabidopsis lyrata subsp. l... 152 4e-35 gb|EPS63069.1| hypothetical protein M569_11717 [Genlisea aurea] 152 5e-35 ref|NP_001078414.1| pentatricopeptide repeat-containing protein ... 151 8e-35 ref|NP_001078415.1| pentatricopeptide repeat-containing protein ... 151 8e-35 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 149 5e-34 ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containi... 148 7e-34 >ref|XP_006468073.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Citrus sinensis] Length = 616 Score = 166 bits (420), Expect = 3e-39 Identities = 77/86 (89%), Positives = 82/86 (95%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NVFADIEEEEKE+ALSYHSEKIAIAFML+NTAP TP+RVVKNLRVCADCH AIKLISKV+ Sbjct: 531 NVFADIEEEEKEDALSYHSEKIAIAFMLVNTAPGTPVRVVKNLRVCADCHLAIKLISKVY 590 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 REIVVRDRSRFHHF+DG CSCRDYW Sbjct: 591 SREIVVRDRSRFHHFKDGHCSCRDYW 616 >ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 610 Score = 163 bits (413), Expect = 2e-38 Identities = 75/86 (87%), Positives = 81/86 (94%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALSYHSEK+AIAFML+NTAP TPIRV+KNLRVCADCH AIKLISKV+ Sbjct: 525 NVLADIEEEEKEQALSYHSEKVAIAFMLLNTAPGTPIRVMKNLRVCADCHMAIKLISKVY 584 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIV+RDRSRFHHFRDG CSC+DYW Sbjct: 585 DREIVIRDRSRFHHFRDGLCSCKDYW 610 >ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] gi|462408515|gb|EMJ13849.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] Length = 604 Score = 162 bits (409), Expect = 6e-38 Identities = 76/86 (88%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALSYHSEKIAIAFM++NTAP PIR+ KNLRVCADCH AIKLISKV+ Sbjct: 519 NVLADIEEEEKEYALSYHSEKIAIAFMILNTAPGIPIRIWKNLRVCADCHLAIKLISKVY 578 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIVVRDRSRFHHFRDGSCSCRDYW Sbjct: 579 DREIVVRDRSRFHHFRDGSCSCRDYW 604 >ref|XP_007041101.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590681507|ref|XP_007041102.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590681511|ref|XP_007041103.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705036|gb|EOX96932.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705037|gb|EOX96933.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705038|gb|EOX96934.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 616 Score = 161 bits (408), Expect = 8e-38 Identities = 75/86 (87%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKENALSYHSEKIAIAFML+ TAP TPIRVVKNLRVCADCH AIKL+SKVF Sbjct: 531 NVLADIEEEEKENALSYHSEKIAIAFMLLKTAPGTPIRVVKNLRVCADCHMAIKLLSKVF 590 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 REI++RDRSRFHHFR+GSCSC DYW Sbjct: 591 KREIIIRDRSRFHHFRNGSCSCMDYW 616 >ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 613 Score = 161 bits (407), Expect = 1e-37 Identities = 77/86 (89%), Positives = 79/86 (91%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALSYHSEKIAIAFMLINTA PIRVVKNLRVCADCH AIKLISKVF Sbjct: 528 NVLADIEEEEKETALSYHSEKIAIAFMLINTAAGIPIRVVKNLRVCADCHLAIKLISKVF 587 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIVVRDRSRFHHF+DG CSC+DYW Sbjct: 588 DREIVVRDRSRFHHFKDGHCSCKDYW 613 >emb|CAN67095.1| hypothetical protein VITISV_016806 [Vitis vinifera] Length = 348 Score = 161 bits (407), Expect = 1e-37 Identities = 77/86 (89%), Positives = 79/86 (91%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALSYHSEKIAIAFMLINTA PIRVVKNLRVCADCH AIKLISKVF Sbjct: 263 NVLADIEEEEKETALSYHSEKIAIAFMLINTAAGIPIRVVKNLRVCADCHLAIKLISKVF 322 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIVVRDRSRFHHF+DG CSC+DYW Sbjct: 323 DREIVVRDRSRFHHFKDGHCSCKDYW 348 >ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum tuberosum] Length = 585 Score = 160 bits (404), Expect = 2e-37 Identities = 75/86 (87%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE AL+YHSEKIAIAFMLI+T P TPIR+VKNLRVCADCH AIKLISKVF Sbjct: 500 NVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTPIRIVKNLRVCADCHLAIKLISKVF 559 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIVVRDRSRFHHF +GSCSC+DYW Sbjct: 560 DREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_003541672.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 607 Score = 159 bits (403), Expect = 3e-37 Identities = 72/86 (83%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALSYHSEK+AIAFML+NT P TPIRV+KNLRVCADCH AIKLI+K++ Sbjct: 522 NVLADIEEEEKEQALSYHSEKVAIAFMLLNTPPGTPIRVMKNLRVCADCHMAIKLIAKIY 581 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIV+RDRSRFHHFR GSCSC+DYW Sbjct: 582 DREIVIRDRSRFHHFRGGSCSCKDYW 607 >ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris] gi|561021163|gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris] Length = 611 Score = 159 bits (403), Expect = 3e-37 Identities = 73/86 (84%), Positives = 79/86 (91%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE AL YHSEK+AIAFML+NTAP PIRVVKNLRVCADCH AIKLISK++ Sbjct: 526 NVLADIEEEEKEQALCYHSEKLAIAFMLLNTAPAAPIRVVKNLRVCADCHVAIKLISKIY 585 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREIV+RDRSRFHHFR GSCSC+DYW Sbjct: 586 DREIVIRDRSRFHHFRGGSCSCKDYW 611 >ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 159 bits (402), Expect = 4e-37 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALS+H+EK+AIAFML+NT P TPIR++KNLRVCADCH AIKLISKVF Sbjct: 524 NVLADIEEEEKETALSHHTEKVAIAFMLVNTPPGTPIRIMKNLRVCADCHLAIKLISKVF 583 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REI+VRDRSRFHHF+DGSCSC+DYW Sbjct: 584 EREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 159 bits (402), Expect = 4e-37 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE ALS+H+EK+AIAFML+NT P TPIR++KNLRVCADCH AIKLISKVF Sbjct: 524 NVLADIEEEEKETALSHHTEKVAIAFMLVNTPPGTPIRIMKNLRVCADCHLAIKLISKVF 583 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REI+VRDRSRFHHF+DGSCSC+DYW Sbjct: 584 EREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_004295634.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 611 Score = 158 bits (400), Expect = 6e-37 Identities = 75/86 (87%), Positives = 79/86 (91%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKENALSYHSEKIAIAFML+ TAP+TPIRV KNLRVCADCH A KLIS+V+ Sbjct: 526 NVLADIEEEEKENALSYHSEKIAIAFMLLITAPQTPIRVWKNLRVCADCHLAFKLISRVY 585 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DR IVVRDRSRFHHFRDGSCSC DYW Sbjct: 586 DRVIVVRDRSRFHHFRDGSCSCSDYW 611 >ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 585 Score = 158 bits (400), Expect = 6e-37 Identities = 74/86 (86%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE AL+YHSEKIAIAFMLI+T P TPIR+VKNLRVCADCH AIKLISKVF Sbjct: 500 NVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTPIRIVKNLRVCADCHLAIKLISKVF 559 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REIVVRDRSRFHHF +GSCSC+DYW Sbjct: 560 EREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_006413827.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum] gi|557114997|gb|ESQ55280.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum] Length = 595 Score = 157 bits (396), Expect = 2e-36 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV+ D+EEEEKEN L YHSEKIAIAFMLI+T K+PIRVVKNLRVCADCH+AIKL+SKV+ Sbjct: 510 NVYVDVEEEEKENVLVYHSEKIAIAFMLISTPEKSPIRVVKNLRVCADCHWAIKLVSKVY 569 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REIVVRDRSRFHHF+DGSCSC+DYW Sbjct: 570 NREIVVRDRSRFHHFKDGSCSCQDYW 595 >ref|XP_002869909.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297315745|gb|EFH46168.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 595 Score = 152 bits (385), Expect = 4e-35 Identities = 69/86 (80%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV+ D+EEEEKENAL YHSEKIAIAFMLI+T + PIRVVKNL+VCADCH AIKL+SKV+ Sbjct: 510 NVYVDVEEEEKENALVYHSEKIAIAFMLISTPERWPIRVVKNLKVCADCHLAIKLVSKVY 569 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REIVVRDRSRFHHF++GSCSC+DYW Sbjct: 570 NREIVVRDRSRFHHFKNGSCSCQDYW 595 >gb|EPS63069.1| hypothetical protein M569_11717 [Genlisea aurea] Length = 601 Score = 152 bits (384), Expect = 5e-35 Identities = 71/86 (82%), Positives = 77/86 (89%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIEEEEKE AL YHSEKIAIAF LINTAP TPIRVVKNLRVCADCH AIKL+SK+F Sbjct: 516 NVLADIEEEEKETALVYHSEKIAIAFALINTAPGTPIRVVKNLRVCADCHVAIKLVSKIF 575 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +RE+VVRD SRFHHF GSCSC+D+W Sbjct: 576 EREVVVRDLSRFHHFARGSCSCKDFW 601 >ref|NP_001078414.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635630|sp|A8MQA3.2|PP330_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21065 gi|332658994|gb|AEE84394.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 595 Score = 151 bits (382), Expect = 8e-35 Identities = 68/86 (79%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV+ D+EEEEKENA+ YHSEKIAIAFMLI+T ++PI VVKNLRVCADCH AIKL+SKV+ Sbjct: 510 NVYVDVEEEEKENAVVYHSEKIAIAFMLISTPERSPITVVKNLRVCADCHLAIKLVSKVY 569 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REIVVRDRSRFHHF++GSCSC+DYW Sbjct: 570 NREIVVRDRSRFHHFKNGSCSCQDYW 595 >ref|NP_001078415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658995|gb|AEE84395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 462 Score = 151 bits (382), Expect = 8e-35 Identities = 68/86 (79%), Positives = 80/86 (93%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV+ D+EEEEKENA+ YHSEKIAIAFMLI+T ++PI VVKNLRVCADCH AIKL+SKV+ Sbjct: 377 NVYVDVEEEEKENAVVYHSEKIAIAFMLISTPERSPITVVKNLRVCADCHLAIKLVSKVY 436 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 +REIVVRDRSRFHHF++GSCSC+DYW Sbjct: 437 NREIVVRDRSRFHHFKNGSCSCQDYW 462 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 149 bits (375), Expect = 5e-34 Identities = 65/86 (75%), Positives = 77/86 (89%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIE+EEKE AL+YHSE++AIAF L+ + P TPIR+VKNLRVC DCH AIKLISK++ Sbjct: 509 NVLADIEDEEKETALNYHSERLAIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKIY 568 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREI+VRDRSRFHHF+ GSCSC+DYW Sbjct: 569 DREIIVRDRSRFHHFKGGSCSCKDYW 594 >ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Brachypodium distachyon] Length = 598 Score = 148 bits (374), Expect = 7e-34 Identities = 65/86 (75%), Positives = 78/86 (90%) Frame = +2 Query: 2 NVFADIEEEEKENALSYHSEKIAIAFMLINTAPKTPIRVVKNLRVCADCHFAIKLISKVF 181 NV ADIE+EEKE+AL+YHSE++AIAF L+ + P TPIR+VKNLRVC DCH AIKLISKV+ Sbjct: 513 NVLADIEDEEKESALNYHSERLAIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKVY 572 Query: 182 DREIVVRDRSRFHHFRDGSCSCRDYW 259 DREI+VRDRSRFHHF+ G+CSC+DYW Sbjct: 573 DREIIVRDRSRFHHFKGGACSCKDYW 598