BLASTX nr result
ID: Paeonia22_contig00042391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042391 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007049480.1| Chlorophyll a-b binding protein 3, chloropla... 60 4e-07 >ref|XP_007049480.1| Chlorophyll a-b binding protein 3, chloroplastic [Theobroma cacao] gi|508701741|gb|EOX93637.1| Chlorophyll a-b binding protein 3, chloroplastic [Theobroma cacao] Length = 275 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 288 RQILGGRPLQTPIGSSRKASFIVRAASTPPVK 383 RQILG RPLQ+PIGSSRK SF+VRAASTPPVK Sbjct: 19 RQILGARPLQSPIGSSRKGSFVVRAASTPPVK 50