BLASTX nr result
ID: Paeonia22_contig00042064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042064 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_002531058.1| pentatricopeptide repeat-containing protein,... 60 4e-07 >ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 585 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 114 KPYIVKKCIALLLTCGSSVYKLKQIHAFSIRRGVLLTN 1 KPYIVKKCI LLL+C SS YK KQ+HAFSIRR + L+N Sbjct: 7 KPYIVKKCITLLLSCASSTYKFKQVHAFSIRRRIPLSN 44 >ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum tuberosum] Length = 585 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 114 KPYIVKKCIALLLTCGSSVYKLKQIHAFSIRRGVLLTN 1 KPYIVKKCIALLL+C SS YK KQ+HAFSIRR + L++ Sbjct: 7 KPYIVKKCIALLLSCASSTYKFKQVHAFSIRRRIPLSS 44 >ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 613 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 114 KPYIVKKCIALLLTCGSSVYKLKQIHAFSIRRGVLLTN 1 K YI+KKCIALLL+C SS +K +QIHAFSIR GV LTN Sbjct: 35 KSYILKKCIALLLSCASSKFKFRQIHAFSIRHGVPLTN 72 >ref|XP_002531058.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529353|gb|EEF31319.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 341 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 111 PYIVKKCIALLLTCGSSVYKLKQIHAFSIRRGVLLTN 1 PYIVKKCIALL C SS YKL+QIHAFSIR GVL N Sbjct: 36 PYIVKKCIALLQICASSKYKLQQIHAFSIRHGVLPNN 72