BLASTX nr result
ID: Paeonia22_contig00042041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042041 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202871.1| hypothetical protein PRUPE_ppa015725mg [Prun... 55 8e-06 >ref|XP_007202871.1| hypothetical protein PRUPE_ppa015725mg [Prunus persica] gi|462398402|gb|EMJ04070.1| hypothetical protein PRUPE_ppa015725mg [Prunus persica] Length = 663 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +2 Query: 2 IDPLCQVGQLSSAEQIIKSMSFVRGHVVWSTLLRACRIMED 124 ID LC+ GQLS AE +IKSM F + VVWSTLLRACR+ D Sbjct: 515 IDLLCRAGQLSEAEHMIKSMPFHQDDVVWSTLLRACRLHGD 555