BLASTX nr result
ID: Paeonia22_contig00042017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00042017 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199716.1| hypothetical protein PRUPE_ppa002128mg [Prun... 38 6e-06 >ref|XP_007199716.1| hypothetical protein PRUPE_ppa002128mg [Prunus persica] gi|462395116|gb|EMJ00915.1| hypothetical protein PRUPE_ppa002128mg [Prunus persica] Length = 712 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -3 Query: 275 PKYPPGRTPADLAYTKEHKGIAGYL 201 P++P GR PADLA HKGI+G+L Sbjct: 397 PEFPLGRAPADLASVNRHKGISGFL 421 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 24/56 (42%), Positives = 30/56 (53%) Frame = -2 Query: 189 LSAYPSSLNLKGFKEGNDVDISGAKAVDINKG*IATAISNGDLPYRLSLDTSLADV 22 L++Y SL + KEG +ISG +AV IAT S D+P LSL SL V Sbjct: 426 LTSYLDSLTMNDAKEGGAAEISGIRAVKTFSERIATPGSYSDMPDALSLKDSLTAV 481