BLASTX nr result
ID: Paeonia22_contig00041906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041906 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ71966.1| hypothetical protein A1O5_04468 [Cladophialophora... 88 1e-15 gb|EXJ79793.1| hypothetical protein A1O3_08078 [Capronia epimyce... 78 1e-12 >gb|EXJ71966.1| hypothetical protein A1O5_04468 [Cladophialophora psammophila CBS 110553] Length = 87 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 151 MVAIKKYIPNFLLPTDEPQAPGRIYDVPLRRHLFHRSEAGNEYTISASRN 2 M A+KKY+P+FLLPTDEPQ PGRIYDVPLRR LFH++ GNEY++SASRN Sbjct: 1 MSALKKYVPSFLLPTDEPQQPGRIYDVPLRRELFHKARPGNEYSVSASRN 50 >gb|EXJ79793.1| hypothetical protein A1O3_08078 [Capronia epimyces CBS 606.96] Length = 89 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 142 IKKYIPNFLLPTDEPQAPGRIYDVPLRRHLFHRSEAGNEYTISAS 8 +KKYIP+FLLPTDEP PG IYDVPLRR LFH++ GNEYT+SAS Sbjct: 3 LKKYIPDFLLPTDEPAVPGPIYDVPLRRELFHKTRPGNEYTLSAS 47