BLASTX nr result
ID: Paeonia22_contig00041570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041570 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003665258.1| hypothetical protein MYCTH_2308798 [Myceliop... 116 4e-24 ref|XP_003654294.1| hypothetical protein THITE_2170642 [Thielavi... 116 4e-24 ref|XP_006692169.1| putative ubiquitin protein [Chaetomium therm... 116 4e-24 ref|XP_001904775.1| hypothetical protein [Podospora anserina S m... 116 4e-24 gb|EWC45036.1| ubiquitin-conjugating enzyme E2 [Drechslerella st... 114 1e-23 emb|CCX15583.1| Similar to Ubiquitin-conjugating enzyme E2-16 kD... 114 1e-23 gb|EPS40322.1| hypothetical protein H072_5886 [Dactylellina hapt... 114 1e-23 gb|EOO03016.1| putative ubiquitin-conjugating enzyme e2-16 kda p... 114 1e-23 gb|ELR03830.1| ubiquitin-conjugating enzyme E2-16 kDa [Pseudogym... 114 1e-23 ref|XP_007582987.1| putative ubiquitin conjugating enzyme protei... 114 1e-23 gb|EGX52566.1| hypothetical protein AOL_s00007g554 [Arthrobotrys... 114 1e-23 ref|XP_007286929.1| ubiquitin conjugating enzyme [Colletotrichum... 114 1e-23 ref|XP_002835470.1| hypothetical protein [Tuber melanosporum Mel... 114 1e-23 ref|XP_003005503.1| ubiquitin-conjugating enzyme [Verticillium a... 114 1e-23 ref|XP_959933.2| hypothetical protein NCU02289 [Neurospora crass... 114 1e-23 gb|ESZ97850.1| ubiquitin-conjugating enzyme E2-16 kDa [Sclerotin... 114 2e-23 gb|EPE36000.1| UBC-like protein [Glarea lozoyensis ATCC 20868] 114 2e-23 gb|ENI04251.1| hypothetical protein COCC4DRAFT_72762 [Bipolaris ... 114 2e-23 gb|EHK98021.1| putative Ubiquitin-conjugating enzyme E2-16 kDa [... 114 2e-23 ref|XP_001932313.1| ubiquitin-conjugating enzyme E2-16 kDa [Pyre... 114 2e-23 >ref|XP_003665258.1| hypothetical protein MYCTH_2308798 [Myceliophthora thermophila ATCC 42464] gi|347012529|gb|AEO60013.1| hypothetical protein MYCTH_2308798 [Myceliophthora thermophila ATCC 42464] Length = 147 Score = 116 bits (290), Expect = 4e-24 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRA+YEQ AREWTRKYAV Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV 147 >ref|XP_003654294.1| hypothetical protein THITE_2170642 [Thielavia terrestris NRRL 8126] gi|347001557|gb|AEO67958.1| hypothetical protein THITE_2170642 [Thielavia terrestris NRRL 8126] Length = 147 Score = 116 bits (290), Expect = 4e-24 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRA+YEQ AREWTRKYAV Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV 147 >ref|XP_006692169.1| putative ubiquitin protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340966643|gb|EGS22150.1| putative ubiquitin protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 147 Score = 116 bits (290), Expect = 4e-24 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRA+YEQ AREWTRKYAV Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV 147 >ref|XP_001904775.1| hypothetical protein [Podospora anserina S mat+] gi|170939454|emb|CAP64682.1| unnamed protein product [Podospora anserina S mat+] Length = 147 Score = 116 bits (290), Expect = 4e-24 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRA+YEQ AREWTRKYAV Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV 147 >gb|EWC45036.1| ubiquitin-conjugating enzyme E2 [Drechslerella stenobrocha 248] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >emb|CCX15583.1| Similar to Ubiquitin-conjugating enzyme E2-16 kDa; acc. no. O74196 [Pyronema omphalodes CBS 100304] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >gb|EPS40322.1| hypothetical protein H072_5886 [Dactylellina haptotyla CBS 200.50] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >gb|EOO03016.1| putative ubiquitin-conjugating enzyme e2-16 kda protein [Togninia minima UCRPA7] Length = 137 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 82 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 137 >gb|ELR03830.1| ubiquitin-conjugating enzyme E2-16 kDa [Pseudogymnoascus destructans 20631-21] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >ref|XP_007582987.1| putative ubiquitin conjugating enzyme protein [Neofusicoccum parvum UCRNP2] gi|407916555|gb|EKG09921.1| Ubiquitin-conjugating enzyme E2 [Macrophomina phaseolina MS6] gi|485924824|gb|EOD49538.1| putative ubiquitin conjugating enzyme protein [Neofusicoccum parvum UCRNP2] gi|494828655|gb|EON65440.1| ubiquitin-conjugating enzyme E2-16 kDa [Coniosporium apollinis CBS 100218] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >gb|EGX52566.1| hypothetical protein AOL_s00007g554 [Arthrobotrys oligospora ATCC 24927] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >ref|XP_007286929.1| ubiquitin conjugating enzyme [Colletotrichum gloeosporioides Nara gc5] gi|615446939|ref|XP_007593527.1| ubiquitin-conjugating enzyme [Colletotrichum fioriniae PJ7] gi|310799289|gb|EFQ34182.1| ubiquitin-conjugating enzyme [Colletotrichum graminicola M1.001] gi|346976145|gb|EGY19597.1| ubiquitin-conjugating enzyme [Verticillium dahliae VdLs.17] gi|380483194|emb|CCF40772.1| ubiquitin-conjugating enzyme E2-16 kDa [Colletotrichum higginsianum] gi|429848544|gb|ELA24011.1| ubiquitin conjugating enzyme [Colletotrichum gloeosporioides Nara gc5] gi|471562429|gb|EMR63929.1| putative ubiquitin-conjugating enzyme e2-16 kda protein [Eutypa lata UCREL1] gi|477524913|gb|ENH76839.1| ubiquitin conjugating enzyme [Colletotrichum orbiculare MAFF 240422] gi|530459931|gb|EQB43379.1| hypothetical protein CGLO_17969 [Colletotrichum gloeosporioides Cg-14] gi|588902581|gb|EXF82829.1| ubiquitin-conjugating enzyme [Colletotrichum fioriniae PJ7] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >ref|XP_002835470.1| hypothetical protein [Tuber melanosporum Mel28] gi|295629254|emb|CAZ79627.1| unnamed protein product [Tuber melanosporum] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >ref|XP_003005503.1| ubiquitin-conjugating enzyme [Verticillium alfalfae VaMs.102] gi|261354919|gb|EEY17347.1| ubiquitin-conjugating enzyme [Verticillium alfalfae VaMs.102] Length = 110 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 55 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 110 >ref|XP_959933.2| hypothetical protein NCU02289 [Neurospora crassa OR74A] gi|336259377|ref|XP_003344490.1| hypothetical protein SMAC_08740 [Sordaria macrospora k-hell] gi|157071564|gb|EAA30697.2| ubiquitin-conjugating enzyme E2 [Neurospora crassa OR74A] gi|336467511|gb|EGO55675.1| hypothetical protein NEUTE1DRAFT_117858 [Neurospora tetrasperma FGSC 2508] gi|350287841|gb|EGZ69077.1| ubiquitin-conjugating enzyme [Neurospora tetrasperma FGSC 2509] gi|380087454|emb|CCC05371.1| unnamed protein product [Sordaria macrospora k-hell] Length = 147 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 >gb|ESZ97850.1| ubiquitin-conjugating enzyme E2-16 kDa [Sclerotinia borealis F-4157] Length = 147 Score = 114 bits (284), Expect = 2e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDR+RYE AREWTRKYAV Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRSRYEATAREWTRKYAV 147 >gb|EPE36000.1| UBC-like protein [Glarea lozoyensis ATCC 20868] Length = 645 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDR+RYE AREWTRKYA+ Sbjct: 590 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 645 >gb|ENI04251.1| hypothetical protein COCC4DRAFT_72762 [Bipolaris maydis ATCC 48331] Length = 556 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDR+RYE AREWTRKYA+ Sbjct: 501 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 556 >gb|EHK98021.1| putative Ubiquitin-conjugating enzyme E2-16 kDa [Glarea lozoyensis 74030] Length = 87 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDR+RYE AREWTRKYA+ Sbjct: 32 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 87 >ref|XP_001932313.1| ubiquitin-conjugating enzyme E2-16 kDa [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330914985|ref|XP_003296861.1| hypothetical protein PTT_07069 [Pyrenophora teres f. teres 0-1] gi|187973919|gb|EDU41418.1| ubiquitin-conjugating enzyme E2-16 kDa [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311330791|gb|EFQ95033.1| hypothetical protein PTT_07069 [Pyrenophora teres f. teres 0-1] gi|451853399|gb|EMD66693.1| hypothetical protein COCSADRAFT_84926 [Bipolaris sorokiniana ND90Pr] gi|452004832|gb|EMD97288.1| hypothetical protein COCHEDRAFT_1018846 [Bipolaris maydis C5] gi|482807802|gb|EOA84735.1| hypothetical protein SETTUDRAFT_163576 [Setosphaeria turcica Et28A] gi|576923856|gb|EUC37970.1| hypothetical protein COCCADRAFT_1204 [Bipolaris zeicola 26-R-13] gi|576936068|gb|EUC49566.1| hypothetical protein COCMIDRAFT_84309 [Bipolaris oryzae ATCC 44560] gi|578487518|gb|EUN24974.1| hypothetical protein COCVIDRAFT_104652 [Bipolaris victoriae FI3] Length = 147 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRARYEQMAREWTRKYAV 168 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDR+RYE AREWTRKYA+ Sbjct: 92 QWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 147