BLASTX nr result
ID: Paeonia22_contig00041566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041566 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161322.1| hypothetical protein PHAVU_001G059900g [Phas... 58 2e-06 ref|XP_007161321.1| hypothetical protein PHAVU_001G059900g [Phas... 58 2e-06 ref|XP_007137155.1| hypothetical protein PHAVU_009G104400g [Phas... 56 6e-06 ref|XP_007137154.1| hypothetical protein PHAVU_009G104400g [Phas... 56 6e-06 >ref|XP_007161322.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] gi|561034786|gb|ESW33316.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] Length = 356 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 250 YGADMSNANGHGNRFINMQNCADLDTYWPSY 158 YGADM+NAN HGNR++ M +C DLD YWPSY Sbjct: 326 YGADMANANSHGNRYMAMDHCMDLDNYWPSY 356 >ref|XP_007161321.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] gi|561034785|gb|ESW33315.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] Length = 340 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 250 YGADMSNANGHGNRFINMQNCADLDTYWPSY 158 YGADM+NAN HGNR++ M +C DLD YWPSY Sbjct: 310 YGADMANANSHGNRYMAMDHCMDLDNYWPSY 340 >ref|XP_007137155.1| hypothetical protein PHAVU_009G104400g [Phaseolus vulgaris] gi|561010242|gb|ESW09149.1| hypothetical protein PHAVU_009G104400g [Phaseolus vulgaris] Length = 357 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -2 Query: 250 YGADMSNANGHGNRFINMQNCADLDTYWPSY 158 YG+++SN N HGNRF+ M++C DLD YWPSY Sbjct: 327 YGSELSNMNSHGNRFMGMEHCMDLDNYWPSY 357 >ref|XP_007137154.1| hypothetical protein PHAVU_009G104400g [Phaseolus vulgaris] gi|561010241|gb|ESW09148.1| hypothetical protein PHAVU_009G104400g [Phaseolus vulgaris] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -2 Query: 250 YGADMSNANGHGNRFINMQNCADLDTYWPSY 158 YG+++SN N HGNRF+ M++C DLD YWPSY Sbjct: 328 YGSELSNMNSHGNRFMGMEHCMDLDNYWPSY 358