BLASTX nr result
ID: Paeonia22_contig00041299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041299 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001766402.1| predicted protein [Physcomitrella patens] gi... 88 1e-15 ref|NP_567844.1| small nuclear ribonucleoprotein E [Arabidopsis ... 87 2e-15 ref|XP_006492012.1| PREDICTED: small nuclear ribonucleoprotein E... 87 2e-15 ref|XP_006427727.1| hypothetical protein CICLE_v10027494mg [Citr... 87 2e-15 ref|NP_179464.1| putative small nuclear ribonucleoprotein [Arabi... 87 2e-15 ref|XP_006453447.1| hypothetical protein CICLE_v10010045mg [Citr... 87 3e-15 gb|ADR71258.1| small nuclear ribonucleoprotein E [Hevea brasilie... 86 4e-15 ref|XP_007212317.1| hypothetical protein PRUPE_ppa014076mg [Prun... 86 5e-15 ref|XP_003549500.1| PREDICTED: small nuclear ribonucleoprotein E... 86 5e-15 ref|XP_004303066.1| PREDICTED: small nuclear ribonucleoprotein E... 86 7e-15 ref|XP_002966380.1| hypothetical protein SELMODRAFT_230895 [Sela... 85 9e-15 gb|ABK21228.1| unknown [Picea sitchensis] 85 9e-15 gb|ABK21652.1| unknown [Picea sitchensis] 85 9e-15 ref|XP_003542280.1| PREDICTED: small nuclear ribonucleoprotein E... 85 1e-14 ref|XP_001757108.1| predicted protein [Physcomitrella patens] gi... 85 1e-14 ref|XP_003523208.1| PREDICTED: small nuclear ribonucleoprotein E... 84 2e-14 gb|ADB02889.1| small nuclear ribonucleoprotein polypeptide [Jatr... 84 2e-14 gb|ACU15277.1| unknown [Glycine max] 84 2e-14 ref|XP_002522808.1| Small nuclear ribonucleoprotein E, putative ... 84 2e-14 ref|XP_006412720.1| hypothetical protein EUTSA_v10026682mg [Eutr... 84 2e-14 >ref|XP_001766402.1| predicted protein [Physcomitrella patens] gi|168048491|ref|XP_001776700.1| predicted protein [Physcomitrella patens] gi|162671992|gb|EDQ58536.1| predicted protein [Physcomitrella patens] gi|162682311|gb|EDQ68730.1| predicted protein [Physcomitrella patens] Length = 87 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVS+KKKTRKPLGRILLKGDNITLMMNTGK Sbjct: 44 GFDEYMNLVLDEAEEVSLKKKTRKPLGRILLKGDNITLMMNTGK 87 >ref|NP_567844.1| small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|297798942|ref|XP_002867355.1| hypothetical protein ARALYDRAFT_913445 [Arabidopsis lyrata subsp. lyrata] gi|565447329|ref|XP_006284849.1| hypothetical protein CARUB_v10006135mg [Capsella rubella] gi|21593343|gb|AAM65292.1| small nuclear ribonucleoprotein homolog [Arabidopsis thaliana] gi|51968366|dbj|BAD42875.1| small nuclear ribonucleoprotein homolog [Arabidopsis thaliana] gi|51968768|dbj|BAD43076.1| small nuclear ribonucleoprotein homolog [Arabidopsis thaliana] gi|51971773|dbj|BAD44551.1| small nuclear ribonucleoprotein homolog [Arabidopsis thaliana] gi|88010920|gb|ABD38873.1| At4g30330 [Arabidopsis thaliana] gi|297313191|gb|EFH43614.1| hypothetical protein ARALYDRAFT_913445 [Arabidopsis lyrata subsp. lyrata] gi|332660353|gb|AEE85753.1| small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|482553554|gb|EOA17747.1| hypothetical protein CARUB_v10006135mg [Capsella rubella] Length = 88 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVSIKKKTRKPLGRILLKGDNITLMMN GK Sbjct: 45 GFDEYMNLVLDEAEEVSIKKKTRKPLGRILLKGDNITLMMNAGK 88 >ref|XP_006492012.1| PREDICTED: small nuclear ribonucleoprotein E-like isoform X2 [Citrus sinensis] Length = 88 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVS+KKK+RKPLGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDEAEEVSVKKKSRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_006427727.1| hypothetical protein CICLE_v10027494mg [Citrus clementina] gi|557529717|gb|ESR40967.1| hypothetical protein CICLE_v10027494mg [Citrus clementina] Length = 47 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVS+KKK+RKPLGRILLKGDNITLMMNTGK Sbjct: 4 GFDEYMNLVLDEAEEVSVKKKSRKPLGRILLKGDNITLMMNTGK 47 >ref|NP_179464.1| putative small nuclear ribonucleoprotein [Arabidopsis thaliana] gi|297836770|ref|XP_002886267.1| hypothetical protein ARALYDRAFT_900374 [Arabidopsis lyrata subsp. lyrata] gi|565482500|ref|XP_006298890.1| hypothetical protein CARUB_v10015010mg [Capsella rubella] gi|567206777|ref|XP_006409116.1| hypothetical protein EUTSA_v10022941mg [Eutrema salsugineum] gi|4185140|gb|AAD08943.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|21592486|gb|AAM64436.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|26452632|dbj|BAC43399.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|28973515|gb|AAO64082.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gi|297332107|gb|EFH62526.1| hypothetical protein ARALYDRAFT_900374 [Arabidopsis lyrata subsp. lyrata] gi|330251706|gb|AEC06800.1| putative small nuclear ribonucleoprotein [Arabidopsis thaliana] gi|482567599|gb|EOA31788.1| hypothetical protein CARUB_v10015010mg [Capsella rubella] gi|557110278|gb|ESQ50569.1| hypothetical protein EUTSA_v10022941mg [Eutrema salsugineum] Length = 88 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVSIKK TRKPLGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_006453447.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] gi|567922884|ref|XP_006453448.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] gi|568840355|ref|XP_006474134.1| PREDICTED: small nuclear ribonucleoprotein E-like [Citrus sinensis] gi|557556673|gb|ESR66687.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] gi|557556674|gb|ESR66688.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] Length = 88 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV IKK TRKPLGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 88 >gb|ADR71258.1| small nuclear ribonucleoprotein E [Hevea brasiliensis] Length = 88 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV+IKKKTRK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVNIKKKTRKSLGRILLKGDNITLMMNTGK 88 >ref|XP_007212317.1| hypothetical protein PRUPE_ppa014076mg [Prunus persica] gi|462408182|gb|EMJ13516.1| hypothetical protein PRUPE_ppa014076mg [Prunus persica] Length = 88 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVSIKKKTRK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDEAEEVSIKKKTRKSLGRILLKGDNITLMMNTGK 88 >ref|XP_003549500.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] gi|255628153|gb|ACU14421.1| unknown [Glycine max] Length = 88 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEVSIKKK+RK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVSIKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_004303066.1| PREDICTED: small nuclear ribonucleoprotein E-like isoform 1 [Fragaria vesca subsp. vesca] Length = 88 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEVSIKK TRK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVSIKKNTRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_002966380.1| hypothetical protein SELMODRAFT_230895 [Selaginella moellendorffii] gi|302792841|ref|XP_002978186.1| hypothetical protein SELMODRAFT_176675 [Selaginella moellendorffii] gi|300154207|gb|EFJ20843.1| hypothetical protein SELMODRAFT_176675 [Selaginella moellendorffii] gi|300165800|gb|EFJ32407.1| hypothetical protein SELMODRAFT_230895 [Selaginella moellendorffii] Length = 88 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDA E+S+KKK+RKPLGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAYEISLKKKSRKPLGRILLKGDNITLMMNTGK 88 >gb|ABK21228.1| unknown [Picea sitchensis] Length = 88 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVL+DAEE+S+K+KT KPLGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLEDAEEISVKRKTHKPLGRILLKGDNITLMMNTGK 88 >gb|ABK21652.1| unknown [Picea sitchensis] Length = 79 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVL+DAEE+S+K+KT KPLGRILLKGDNITLMMNTGK Sbjct: 36 GFDEYMNLVLEDAEEISVKRKTHKPLGRILLKGDNITLMMNTGK 79 >ref|XP_003542280.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] gi|255627911|gb|ACU14300.1| unknown [Glycine max] Length = 88 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV+IKKK+RK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVNIKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_001757108.1| predicted protein [Physcomitrella patens] gi|162691606|gb|EDQ77967.1| predicted protein [Physcomitrella patens] Length = 87 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVL++AEEVS+KK TRKPLGRILLKGDNITLMMNTGK Sbjct: 44 GFDEYMNLVLEEAEEVSLKKNTRKPLGRILLKGDNITLMMNTGK 87 >ref|XP_003523208.1| PREDICTED: small nuclear ribonucleoprotein E-like [Glycine max] gi|356516401|ref|XP_003526883.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] gi|502098396|ref|XP_004491225.1| PREDICTED: small nuclear ribonucleoprotein E-like [Cicer arietinum] gi|388501720|gb|AFK38926.1| unknown [Lotus japonicus] Length = 88 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV++KKK+RK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >gb|ADB02889.1| small nuclear ribonucleoprotein polypeptide [Jatropha curcas] Length = 88 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV++KKKTRK LGRILLKGDNITLMMN+GK Sbjct: 45 GFDEYMNLVLDDAEEVNVKKKTRKSLGRILLKGDNITLMMNSGK 88 >gb|ACU15277.1| unknown [Glycine max] Length = 88 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV++KKK+RK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_002522808.1| Small nuclear ribonucleoprotein E, putative [Ricinus communis] gi|223538046|gb|EEF39659.1| Small nuclear ribonucleoprotein E, putative [Ricinus communis] Length = 88 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLDDAEEV++KKK+RK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_006412720.1| hypothetical protein EUTSA_v10026682mg [Eutrema salsugineum] gi|557113890|gb|ESQ54173.1| hypothetical protein EUTSA_v10026682mg [Eutrema salsugineum] Length = 88 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 323 GFDEYMNLVLDDAEEVSIKKKTRKPLGRILLKGDNITLMMNTGK 192 GFDEYMNLVLD+AEEVSIKK TRK LGRILLKGDNITLMMNTGK Sbjct: 45 GFDEYMNLVLDEAEEVSIKKNTRKQLGRILLKGDNITLMMNTGK 88