BLASTX nr result
ID: Paeonia22_contig00041120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041120 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028057.1| Uncharacterized protein TCM_023124 [Theobrom... 72 8e-11 ref|XP_006481640.1| PREDICTED: uncharacterized protein LOC102612... 71 2e-10 ref|XP_006430011.1| hypothetical protein CICLE_v10013205mg [Citr... 71 2e-10 ref|XP_003632560.1| PREDICTED: uncharacterized protein LOC100854... 67 2e-09 ref|XP_002322766.1| hypothetical protein POPTR_0016s06650g [Popu... 63 5e-08 gb|EXC26393.1| hypothetical protein L484_006444 [Morus notabilis] 62 6e-08 ref|XP_002524097.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_007203170.1| hypothetical protein PRUPE_ppa024490mg [Prun... 62 8e-08 gb|EYU38704.1| hypothetical protein MIMGU_mgv1a024152mg [Mimulus... 61 2e-07 gb|EYU18149.1| hypothetical protein MIMGU_mgv1a016494mg [Mimulus... 60 2e-07 ref|XP_004228730.1| PREDICTED: uncharacterized protein LOC101252... 58 2e-06 ref|XP_002309265.1| hypothetical protein POPTR_0006s21430g [Popu... 57 2e-06 ref|XP_004494276.1| PREDICTED: uncharacterized protein LOC101511... 57 3e-06 ref|XP_006403813.1| hypothetical protein EUTSA_v10010863mg [Eutr... 56 6e-06 ref|XP_006339330.1| PREDICTED: uncharacterized protein LOC102590... 55 8e-06 >ref|XP_007028057.1| Uncharacterized protein TCM_023124 [Theobroma cacao] gi|508716662|gb|EOY08559.1| Uncharacterized protein TCM_023124 [Theobroma cacao] Length = 129 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M SVGAGFMAVFAVSGSVVFIA +VHKRLLSDFMKKIESE Sbjct: 1 MEGSVGAGFMAVFAVSGSVVFIAREVHKRLLSDFMKKIESE 41 >ref|XP_006481640.1| PREDICTED: uncharacterized protein LOC102612786 [Citrus sinensis] Length = 93 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 MG+S+G GFMAVFAVSGSVV +A QVHKRLLSDFMKKIESE Sbjct: 1 MGASMGMGFMAVFAVSGSVVLVASQVHKRLLSDFMKKIESE 41 >ref|XP_006430011.1| hypothetical protein CICLE_v10013205mg [Citrus clementina] gi|557532068|gb|ESR43251.1| hypothetical protein CICLE_v10013205mg [Citrus clementina] Length = 93 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 MG+S+G GFMAVFAVSGSVV +A QVHKRLLSDFMKKIESE Sbjct: 1 MGASMGMGFMAVFAVSGSVVLVASQVHKRLLSDFMKKIESE 41 >ref|XP_003632560.1| PREDICTED: uncharacterized protein LOC100854533 [Vitis vinifera] gi|296089347|emb|CBI39119.3| unnamed protein product [Vitis vinifera] Length = 120 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 129 IEMGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 +E + +G GFMAVFAVSGS V IALQ+HKRLLSDFMKKIESE Sbjct: 1 MEGSAGIGVGFMAVFAVSGSAVLIALQLHKRLLSDFMKKIESE 43 >ref|XP_002322766.1| hypothetical protein POPTR_0016s06650g [Populus trichocarpa] gi|222867396|gb|EEF04527.1| hypothetical protein POPTR_0016s06650g [Populus trichocarpa] Length = 99 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M S+G GFMA FAVSGSVV IA QVHKRLLSDFMKK+E E Sbjct: 1 MQGSMGLGFMAAFAVSGSVVLIARQVHKRLLSDFMKKMEFE 41 >gb|EXC26393.1| hypothetical protein L484_006444 [Morus notabilis] Length = 138 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M SS+G GFMAVFAV+GSVV +A Q+HKRLLSDFMK IE E Sbjct: 1 MESSLGVGFMAVFAVTGSVVILAHQIHKRLLSDFMKDIEFE 41 >ref|XP_002524097.1| conserved hypothetical protein [Ricinus communis] gi|223536665|gb|EEF38307.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 117 SSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 S++G GFMA FAVSGSVV IA QVHKRL+SDFMKKIE E Sbjct: 8 STMGLGFMAAFAVSGSVVLIARQVHKRLVSDFMKKIECE 46 >ref|XP_007203170.1| hypothetical protein PRUPE_ppa024490mg [Prunus persica] gi|462398701|gb|EMJ04369.1| hypothetical protein PRUPE_ppa024490mg [Prunus persica] Length = 117 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M +S+G GFMAV AVSGSVV +A QVHKRLLSDFMK IE E Sbjct: 1 MDNSIGVGFMAVVAVSGSVVLLAHQVHKRLLSDFMKNIECE 41 >gb|EYU38704.1| hypothetical protein MIMGU_mgv1a024152mg [Mimulus guttatus] Length = 118 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 117 SSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 +S+G+ FMAVFAVSGSVV +A+QVHKRLLS+FMKK+E E Sbjct: 5 NSMGSSFMAVFAVSGSVVLLAMQVHKRLLSNFMKKMEFE 43 >gb|EYU18149.1| hypothetical protein MIMGU_mgv1a016494mg [Mimulus guttatus] Length = 119 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M +S+ AGFMAVFAVSGSVVF+++Q HKRLLS+F KK+E E Sbjct: 1 MDNSLKAGFMAVFAVSGSVVFLSMQAHKRLLSNFFKKMEFE 41 >ref|XP_004228730.1| PREDICTED: uncharacterized protein LOC101252916 [Solanum lycopersicum] Length = 109 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 117 SSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 SS+GAG AVFAVSG VV +A +VHK LLSDFMKKIE E Sbjct: 4 SSLGAGIFAVFAVSGGVVLLASKVHKHLLSDFMKKIEFE 42 >ref|XP_002309265.1| hypothetical protein POPTR_0006s21430g [Populus trichocarpa] gi|222855241|gb|EEE92788.1| hypothetical protein POPTR_0006s21430g [Populus trichocarpa] Length = 89 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M +G GFMA FAVSGS+V IA Q+HKRLLSDFMK++E E Sbjct: 1 MAGYLGIGFMAAFAVSGSLVLIARQLHKRLLSDFMKQMEFE 41 >ref|XP_004494276.1| PREDICTED: uncharacterized protein LOC101511111 [Cicer arietinum] Length = 143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M SS+ G MAVFAVSGS+VF+A QVHKR+LS+FMKK E E Sbjct: 1 MESSMRFGLMAVFAVSGSMVFLAHQVHKRILSNFMKKFEFE 41 >ref|XP_006403813.1| hypothetical protein EUTSA_v10010863mg [Eutrema salsugineum] gi|557104932|gb|ESQ45266.1| hypothetical protein EUTSA_v10010863mg [Eutrema salsugineum] Length = 88 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 102 GFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 GFMAVFAVSGSVVF+A Q HKRLLSD+M+K E E Sbjct: 6 GFMAVFAVSGSVVFLASQFHKRLLSDYMEKFEFE 39 >ref|XP_006339330.1| PREDICTED: uncharacterized protein LOC102590574 [Solanum tuberosum] Length = 164 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -1 Query: 123 MGSSVGAGFMAVFAVSGSVVFIALQVHKRLLSDFMKKIESE 1 M +S+G FMAVFAVSGSVV +A++VH+ LLSDF+ K+E++ Sbjct: 1 MENSLGCAFMAVFAVSGSVVLLAMKVHQHLLSDFINKLETQ 41