BLASTX nr result
ID: Paeonia22_contig00041109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041109 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206343.1| hypothetical protein PRUPE_ppa017529mg [Prun... 100 4e-19 ref|XP_002323105.2| hypothetical protein POPTR_0016s14910g [Popu... 97 3e-18 ref|XP_004305061.1| PREDICTED: mediator of RNA polymerase II tra... 92 6e-17 ref|XP_006429661.1| hypothetical protein CICLE_v10010920mg [Citr... 87 2e-15 ref|XP_007030362.1| Reduced epidermal fluorescence 4, putative i... 86 4e-15 ref|XP_007140028.1| hypothetical protein PHAVU_008G078200g [Phas... 85 9e-15 gb|EXC35212.1| hypothetical protein L484_022767 [Morus notabilis] 84 2e-14 emb|CAQ58623.1| unknown gene [Vitis vinifera] 84 2e-14 emb|CBI31143.3| unnamed protein product [Vitis vinifera] 83 5e-14 ref|XP_002264843.1| PREDICTED: uncharacterized protein LOC100258... 83 5e-14 emb|CAN60712.1| hypothetical protein VITISV_036441 [Vitis vinifera] 83 5e-14 ref|XP_006602736.1| PREDICTED: mediator of RNA polymerase II tra... 82 6e-14 ref|XP_006842623.1| hypothetical protein AMTR_s00077p00181380 [A... 82 8e-14 ref|XP_004298175.1| PREDICTED: mediator of RNA polymerase II tra... 76 6e-12 ref|XP_003623670.1| hypothetical protein MTR_7g074290 [Medicago ... 72 8e-11 ref|XP_004492606.1| PREDICTED: mediator of RNA polymerase II tra... 72 1e-10 ref|XP_004492605.1| PREDICTED: mediator of RNA polymerase II tra... 72 1e-10 ref|XP_003594101.1| hypothetical protein MTR_2g021390 [Medicago ... 72 1e-10 ref|XP_003557381.1| PREDICTED: uncharacterized protein LOC100828... 71 1e-10 ref|XP_004486115.1| PREDICTED: mediator of RNA polymerase II tra... 71 2e-10 >ref|XP_007206343.1| hypothetical protein PRUPE_ppa017529mg [Prunus persica] gi|462401985|gb|EMJ07542.1| hypothetical protein PRUPE_ppa017529mg [Prunus persica] Length = 1316 Score = 99.8 bits (247), Expect = 4e-19 Identities = 54/89 (60%), Positives = 63/89 (70%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RERDPLEGP+PHLE RL VLL IVPLAIA+V++D ++ SS++GD SG ME Sbjct: 372 RERDPLEGPIPHLEARLCVLLSIVPLAIANVLEDKIKVNSSSIEGDTVSGNMESGYGDEM 431 Query: 160 -----TSRKHALISSLQILGQFSGLLSPP 231 TSRK LISSLQ+LG FSGLL PP Sbjct: 432 DGKANTSRKQGLISSLQVLGNFSGLLCPP 460 >ref|XP_002323105.2| hypothetical protein POPTR_0016s14910g [Populus trichocarpa] gi|550321539|gb|EEF04866.2| hypothetical protein POPTR_0016s14910g [Populus trichocarpa] Length = 1346 Score = 96.7 bits (239), Expect = 3e-18 Identities = 53/90 (58%), Positives = 62/90 (68%), Gaps = 13/90 (14%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RE DPLEGP+PHLE+RL +LL IVPLAIA+++DD SSLQG SG +E Sbjct: 402 REHDPLEGPIPHLESRLCILLTIVPLAIANIMDDEAKFCSSSLQGAAKSGFIEIDGHENQ 461 Query: 160 ------TSRKHALISSLQILGQFSGLLSPP 231 TSRK+ LISSLQ+LGQFSGLL PP Sbjct: 462 VDGKGQTSRKNGLISSLQVLGQFSGLLCPP 491 >ref|XP_004305061.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33B-like [Fragaria vesca subsp. vesca] Length = 1243 Score = 92.4 bits (228), Expect = 6e-17 Identities = 54/88 (61%), Positives = 64/88 (72%), Gaps = 12/88 (13%) Frame = +1 Query: 4 ERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME-------- 159 ERDPLEGP+PHLE+RL VLL IVPLAIA+V++D +L+ SSL+ D AS +E Sbjct: 302 ERDPLEGPIPHLESRLCVLLSIVPLAIANVLEDEANLNSSSLK-DTASRNVENGDGHEMN 360 Query: 160 ----TSRKHALISSLQILGQFSGLLSPP 231 TSRKH LISSL+ILG FSGLL PP Sbjct: 361 SKASTSRKHGLISSLKILGNFSGLLCPP 388 >ref|XP_006429661.1| hypothetical protein CICLE_v10010920mg [Citrus clementina] gi|568855339|ref|XP_006481264.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Citrus sinensis] gi|557531718|gb|ESR42901.1| hypothetical protein CICLE_v10010920mg [Citrus clementina] Length = 1328 Score = 87.0 bits (214), Expect = 2e-15 Identities = 47/89 (52%), Positives = 58/89 (65%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCMET------ 162 RERDP EGP+PHLE RL +LL IVPLAIA+V+ + ++ S+LQG SG +ET Sbjct: 383 RERDPPEGPLPHLEARLGILLSIVPLAIANVLAEQANIQLSTLQGSKTSGSIETGCGHGM 442 Query: 163 ------SRKHALISSLQILGQFSGLLSPP 231 S+K L+SSLQ LG FS LL PP Sbjct: 443 EEKSLASKKEGLVSSLQALGNFSALLCPP 471 >ref|XP_007030362.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] gi|590641905|ref|XP_007030363.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] gi|590641908|ref|XP_007030364.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] gi|508718967|gb|EOY10864.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] gi|508718968|gb|EOY10865.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] gi|508718969|gb|EOY10866.1| Reduced epidermal fluorescence 4, putative isoform 1 [Theobroma cacao] Length = 1312 Score = 86.3 bits (212), Expect = 4e-15 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 6/83 (7%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQ------GDMASGCMET 162 RERDPLEGP+PHLE RL +LL IVPLAIA+V +D L SS Q G GC T Sbjct: 380 RERDPLEGPIPHLEARLCILLSIVPLAIANVFEDEAKLQSSSSQESRYEDGMGEKGCDAT 439 Query: 163 SRKHALISSLQILGQFSGLLSPP 231 K LIS+LQ+LG FSGLLSPP Sbjct: 440 --KSGLISALQLLGNFSGLLSPP 460 >ref|XP_007140028.1| hypothetical protein PHAVU_008G078200g [Phaseolus vulgaris] gi|561013161|gb|ESW12022.1| hypothetical protein PHAVU_008G078200g [Phaseolus vulgaris] Length = 960 Score = 85.1 bits (209), Expect = 9e-15 Identities = 48/82 (58%), Positives = 56/82 (68%), Gaps = 5/82 (6%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGC-----METS 165 RERDP EGP+PHL RL VLLCIVPLAIA+V+ D +FSS+Q M S C + S Sbjct: 387 RERDPPEGPIPHLVARLCVLLCIVPLAIANVLRDDAEHNFSSVQVSMESECTHEMKSDDS 446 Query: 166 RKHALISSLQILGQFSGLLSPP 231 K LISS+Q+LG FS LL PP Sbjct: 447 MKLELISSVQVLGHFSCLLCPP 468 >gb|EXC35212.1| hypothetical protein L484_022767 [Morus notabilis] Length = 1321 Score = 84.3 bits (207), Expect = 2e-14 Identities = 49/88 (55%), Positives = 54/88 (61%), Gaps = 11/88 (12%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSL-----------QGDMAS 147 RERDPLEGPVPHLE RL VLL IVPLAI+ V++D L+ SS G S Sbjct: 379 RERDPLEGPVPHLEARLCVLLSIVPLAISKVLEDETQLYPSSHPSTIVSGYETDHGHGMS 438 Query: 148 GCMETSRKHALISSLQILGQFSGLLSPP 231 G RKH LISSL +LGQF LL PP Sbjct: 439 GKTRVPRKHGLISSLHVLGQFPALLCPP 466 >emb|CAQ58623.1| unknown gene [Vitis vinifera] Length = 1472 Score = 84.3 bits (207), Expect = 2e-14 Identities = 48/89 (53%), Positives = 56/89 (62%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RERDPLEGP+PHLE+RL +LL IVPLAI +++D + SS QG G E Sbjct: 475 RERDPLEGPIPHLESRLCMLLSIVPLAITQLLEDEVNSCNSSSQGGREYGYTEIGYGHEM 534 Query: 160 -----TSRKHALISSLQILGQFSGLLSPP 231 SRKH LISSLQ+LG FS LL PP Sbjct: 535 DRKCHASRKHGLISSLQVLGHFSALLCPP 563 >emb|CBI31143.3| unnamed protein product [Vitis vinifera] Length = 1342 Score = 82.8 bits (203), Expect = 5e-14 Identities = 47/89 (52%), Positives = 55/89 (61%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RERDPLEGP+PHLE+RL +LL I PLAI +++D + SS QG G E Sbjct: 393 RERDPLEGPIPHLESRLCMLLSIAPLAITQLLEDEVNSCNSSSQGGREYGYTEIGYGHEM 452 Query: 160 -----TSRKHALISSLQILGQFSGLLSPP 231 SRKH LISSLQ+LG FS LL PP Sbjct: 453 DRKCHASRKHGLISSLQVLGHFSALLCPP 481 >ref|XP_002264843.1| PREDICTED: uncharacterized protein LOC100258764 [Vitis vinifera] Length = 1330 Score = 82.8 bits (203), Expect = 5e-14 Identities = 47/89 (52%), Positives = 55/89 (61%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RERDPLEGP+PHLE+RL +LL I PLAI +++D + SS QG G E Sbjct: 382 RERDPLEGPIPHLESRLCMLLSIAPLAITQLLEDEVNSCNSSSQGGREYGYTEIGYGHEM 441 Query: 160 -----TSRKHALISSLQILGQFSGLLSPP 231 SRKH LISSLQ+LG FS LL PP Sbjct: 442 DRKCHASRKHGLISSLQVLGHFSALLCPP 470 >emb|CAN60712.1| hypothetical protein VITISV_036441 [Vitis vinifera] Length = 1237 Score = 82.8 bits (203), Expect = 5e-14 Identities = 47/89 (52%), Positives = 55/89 (61%), Gaps = 12/89 (13%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME------- 159 RERDPLEGP+PHLE+RL +LL I PLAI +++D + SS QG G E Sbjct: 337 RERDPLEGPIPHLESRLCMLLSIAPLAITQLLEDEVNSCNSSSQGGREYGYTEIGYGHEM 396 Query: 160 -----TSRKHALISSLQILGQFSGLLSPP 231 SRKH LISSLQ+LG FS LL PP Sbjct: 397 DRKCHASRKHGLISSLQVLGHFSALLCPP 425 >ref|XP_006602736.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Glycine max] Length = 1332 Score = 82.4 bits (202), Expect = 6e-14 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 5/82 (6%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCME-----TS 165 RERDP EGP+PHL RL VLLCIVPLAIA+V+ D + SS+Q M S +S Sbjct: 384 RERDPPEGPIPHLVARLCVLLCIVPLAIANVLRDDSEHNSSSVQVSMESEYRHEMKSGSS 443 Query: 166 RKHALISSLQILGQFSGLLSPP 231 K LISS+Q+LG FSGLL PP Sbjct: 444 MKLGLISSVQVLGHFSGLLCPP 465 >ref|XP_006842623.1| hypothetical protein AMTR_s00077p00181380 [Amborella trichopoda] gi|548844709|gb|ERN04298.1| hypothetical protein AMTR_s00077p00181380 [Amborella trichopoda] Length = 1314 Score = 82.0 bits (201), Expect = 8e-14 Identities = 47/88 (53%), Positives = 56/88 (63%), Gaps = 11/88 (12%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMA-----------S 147 RERDPLEGPVPHL+ RL VLL I PLA A V+++ D S + G + Sbjct: 378 RERDPLEGPVPHLDARLCVLLSITPLAAARVIEE-DMEDSSLINGGVTQNSGTTDEHGKD 436 Query: 148 GCMETSRKHALISSLQILGQFSGLLSPP 231 G + TSR+ LISSLQ+LGQFSGLL PP Sbjct: 437 GNLPTSRRQGLISSLQVLGQFSGLLLPP 464 >ref|XP_004298175.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Fragaria vesca subsp. vesca] Length = 1322 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/81 (44%), Positives = 57/81 (70%), Gaps = 4/81 (4%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCMET----SR 168 RERDP+EGPVP L++RL +LLCI L +A+++++ +L + ++ +G E +R Sbjct: 379 RERDPIEGPVPRLDSRLCMLLCITTLVVANLLEEEGTLPTNEVECTSINGWKEKELPGNR 438 Query: 169 KHALISSLQILGQFSGLLSPP 231 +H L+SSLQ+LG + GLL+PP Sbjct: 439 RHDLVSSLQVLGDYQGLLTPP 459 >ref|XP_003623670.1| hypothetical protein MTR_7g074290 [Medicago truncatula] gi|355498685|gb|AES79888.1| hypothetical protein MTR_7g074290 [Medicago truncatula] Length = 1320 Score = 72.0 bits (175), Expect = 8e-11 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGC-----METS 165 RERDP EGP+PHLE RL +LL IVPL I +V+ D + S+ + S + S Sbjct: 379 RERDPPEGPIPHLEARLCMLLSIVPLVIVNVLRDDTEHNLSTAPVSVGSEYKHEMKSDLS 438 Query: 166 RKHALISSLQILGQFSGLLSPP 231 K LISS+Q+LG FSGLL PP Sbjct: 439 MKLGLISSVQVLGHFSGLLCPP 460 >ref|XP_004492606.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Cicer arietinum] Length = 1263 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/78 (52%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMAS-GCMETSRKHA 177 RERDP EGP+PHLE RL +LL IVPLA+ V+ D + SS+ + S E Sbjct: 326 RERDPPEGPIPHLEARLCMLLSIVPLAVLDVLRDDSEHNPSSVPVPVKSENRYEKQAVCG 385 Query: 178 LISSLQILGQFSGLLSPP 231 L+SS+Q+LGQFSGLL PP Sbjct: 386 LMSSVQVLGQFSGLLCPP 403 >ref|XP_004492605.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Cicer arietinum] Length = 1318 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/78 (52%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMAS-GCMETSRKHA 177 RERDP EGP+PHLE RL +LL IVPLA+ V+ D + SS+ + S E Sbjct: 381 RERDPPEGPIPHLEARLCMLLSIVPLAVLDVLRDDSEHNPSSVPVPVKSENRYEKQAVCG 440 Query: 178 LISSLQILGQFSGLLSPP 231 L+SS+Q+LGQFSGLL PP Sbjct: 441 LMSSVQVLGQFSGLLCPP 458 >ref|XP_003594101.1| hypothetical protein MTR_2g021390 [Medicago truncatula] gi|355483149|gb|AES64352.1| hypothetical protein MTR_2g021390 [Medicago truncatula] Length = 570 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 7/84 (8%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSL---QGDMASGCMET--- 162 RERDP+EGP+PHLETRL +LLCI+PL +A+ +++ + +++ GD E Sbjct: 374 RERDPIEGPMPHLETRLCMLLCIIPLVVANFIEEDEEEEQTTIDEKDGDPTDQWKEKRFP 433 Query: 163 -SRKHALISSLQILGQFSGLLSPP 231 ++ L+SSLQ+LG + LL+PP Sbjct: 434 GKCRNDLVSSLQVLGDYQSLLTPP 457 >ref|XP_003557381.1| PREDICTED: uncharacterized protein LOC100828721 [Brachypodium distachyon] Length = 1268 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/77 (45%), Positives = 49/77 (63%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCMETSRKHAL 180 RER+P+EGPVPHLETRL +LL I LA+A ++++ DS H + L + + L Sbjct: 330 REREPIEGPVPHLETRLCMLLSIATLAVADIIEEADSCH-NELNNHWKGKSAKDDLRKEL 388 Query: 181 ISSLQILGQFSGLLSPP 231 + SLQ+LG + LL PP Sbjct: 389 MLSLQVLGDYESLLVPP 405 >ref|XP_004486115.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X3 [Cicer arietinum] Length = 1143 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 5/82 (6%) Frame = +1 Query: 1 RERDPLEGPVPHLETRLSVLLCIVPLAIAHVVDDVDSLHFSSLQGDMASGCMETSR---- 168 RERDP+EGP+PHL+TRL +LLCI PL +A+++++ + + + D + + R Sbjct: 194 RERDPIEGPMPHLDTRLCMLLCITPLVVANLIEEEEPIPID--EKDSVTDHWKEKRVPGK 251 Query: 169 -KHALISSLQILGQFSGLLSPP 231 ++ L+SSLQ+LG + LL+PP Sbjct: 252 CRNDLVSSLQVLGDYQSLLTPP 273