BLASTX nr result
ID: Paeonia22_contig00041084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041084 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007044545.1| Serine-threonine protein kinase, putative [T... 50 8e-07 >ref|XP_007044545.1| Serine-threonine protein kinase, putative [Theobroma cacao] gi|508708480|gb|EOY00377.1| Serine-threonine protein kinase, putative [Theobroma cacao] Length = 615 Score = 50.4 bits (119), Expect(2) = 8e-07 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -3 Query: 245 IEKLTTEVGGCSNYSIKDVKRRLENHLKNLVKYYKHLGSYG*FVQACSTYLKRW 84 I+KLT+ GGCS+Y++ DV +L LKNL + K L + G Q+C T L+RW Sbjct: 125 IQKLTSGAGGCSDYTVTDVVDKLGARLKNLQEDCKILATDGRLDQSCGTCLRRW 178 Score = 28.1 bits (61), Expect(2) = 8e-07 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 75 LGNNKDSKKNESDACKFTVLVLMTS 1 +G + D K+ +D C+F VLV M S Sbjct: 181 IGGSSDYKQESADVCRFAVLVSMIS 205