BLASTX nr result
ID: Paeonia22_contig00041080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00041080 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635931.1| Cellular nucleic acid-binding protein [Medic... 59 9e-07 ref|XP_003605727.1| Cellular nucleic acid-binding protein [Medic... 55 8e-06 >ref|XP_003635931.1| Cellular nucleic acid-binding protein [Medicago truncatula] gi|355501866|gb|AES83069.1| Cellular nucleic acid-binding protein [Medicago truncatula] Length = 558 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 2/95 (2%) Frame = +1 Query: 1 RAFKFMQCMEVEKVKLGANYLSGKSRQ*WESIL--AEIDTETYTWT*FKNRFYSRYFSAI 174 R F+ MQC EV+KV+ GA+ L+ ++ W S+L E D TW F+ F +RYF Sbjct: 108 RVFRVMQCSEVQKVRFGAHMLAEEAEDWWVSLLPILEQDGVAVTWAVFRREFLNRYFPED 167 Query: 175 KRMWLKREFCNISQKLEEMVAQYLSQFSDLYHFVP 279 R + EF + Q + V +Y+++F +L F P Sbjct: 168 VRGKKEIEFLELKQG-DMSVTEYVAKFVELAKFYP 201 >ref|XP_003605727.1| Cellular nucleic acid-binding protein [Medicago truncatula] gi|355506782|gb|AES87924.1| Cellular nucleic acid-binding protein [Medicago truncatula] Length = 458 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 2/95 (2%) Frame = +1 Query: 1 RAFKFMQCMEVEKVKLGANYLSGKSRQ*WESIL--AEIDTETYTWT*FKNRFYSRYFSAI 174 R F+ MQC EV+KV+ G + L+ ++ W S+L E D TW F+ F +RYF Sbjct: 65 RIFRVMQCSEVQKVRFGTHMLAEEADDWWVSLLPVLEQDGAVVTWAVFRREFLNRYFPED 124 Query: 175 KRMWLKREFCNISQKLEEMVAQYLSQFSDLYHFVP 279 R + EF + Q + V +Y ++F +L F P Sbjct: 125 VRGKKEIEFLELKQG-DMSVTEYAAKFVELAKFYP 158