BLASTX nr result
ID: Paeonia22_contig00040813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040813 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015478.1| Thioesterase superfamily protein, putative i... 56 5e-06 ref|XP_007015477.1| Thioesterase superfamily protein isoform 1 [... 56 5e-06 >ref|XP_007015478.1| Thioesterase superfamily protein, putative isoform 2 [Theobroma cacao] gi|508785841|gb|EOY33097.1| Thioesterase superfamily protein, putative isoform 2 [Theobroma cacao] Length = 170 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 160 YSAKFSTKCFKNGDHLVLDGEAMAILPTLALA*VQ 56 Y AKFSTKCFKNG LVLDGEAM ILPTLA+ VQ Sbjct: 133 YLAKFSTKCFKNGQLLVLDGEAMTILPTLAVEQVQ 167 >ref|XP_007015477.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao] gi|508785840|gb|EOY33096.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao] Length = 166 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 160 YSAKFSTKCFKNGDHLVLDGEAMAILPTLALA*VQ 56 Y AKFSTKCFKNG LVLDGEAM ILPTLA+ VQ Sbjct: 129 YLAKFSTKCFKNGQLLVLDGEAMTILPTLAVEQVQ 163