BLASTX nr result
ID: Paeonia22_contig00040772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040772 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001261887.1| zinc-binding alcohol dehydrogenase, putative... 78 1e-12 ref|XP_001216521.1| conserved hypothetical protein [Aspergillus ... 78 1e-12 ref|XP_746963.1| zinc-binding alcohol dehydrogenase [Aspergillus... 78 1e-12 ref|XP_001275066.1| zinc-binding alcohol dehydrogenase, putative... 78 1e-12 dbj|GAA90875.1| zinc-binding alcohol dehydrogenase [Aspergillus ... 77 2e-12 ref|XP_001390518.1| quinone oxidoreductase [Aspergillus niger CB... 77 2e-12 ref|XP_007581394.1| putative alcohol dehydrogenase superfamily z... 76 4e-12 gb|ENH88929.1| nadp-dependent alcohol dehydrogenase [Colletotric... 74 2e-11 ref|XP_001827625.1| quinone oxidoreductase [Aspergillus oryzae R... 74 2e-11 ref|XP_002384866.1| zinc-binding alcohol dehydrogenase, putative... 74 2e-11 ref|XP_002560467.1| Pc16g00450 [Penicillium chrysogenum Wisconsi... 74 2e-11 gb|EMR67494.1| putative nadp-dependent alcohol dehydrogenase pro... 73 4e-11 gb|EFQ32461.1| zinc-binding dehydrogenase [Colletotrichum gramin... 73 4e-11 gb|EPS26266.1| hypothetical protein PDE_01202 [Penicillium oxali... 73 5e-11 ref|XP_001598795.1| hypothetical protein SS1G_00884 [Sclerotinia... 73 5e-11 gb|EKG21809.1| Alcohol dehydrogenase superfamily zinc-containing... 72 6e-11 gb|EYE91954.1| alcohol dehydrogenase [Aspergillus ruber CBS 135680] 72 8e-11 gb|ESZ90848.1| putative NADP-dependent alcohol dehydrogenase C 2... 72 8e-11 gb|EPS26795.1| hypothetical protein PDE_01734 [Penicillium oxali... 72 8e-11 ref|XP_002488258.1| zinc-binding alcohol dehydrogenase, putative... 72 8e-11 >ref|XP_001261887.1| zinc-binding alcohol dehydrogenase, putative [Neosartorya fischeri NRRL 181] gi|119410043|gb|EAW19990.1| zinc-binding alcohol dehydrogenase, putative [Neosartorya fischeri NRRL 181] Length = 361 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREML+LAA++ VHPWI+ER MKDAN+ ++D D GKARYRY LVN+Q Sbjct: 314 EIREMLQLAAEKGVHPWIQERPMKDANQAVIDMDAGKARYRYVLVNDQ 361 >ref|XP_001216521.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114190462|gb|EAU32162.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 360 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLELAA++KVHPWIEE MK+ANK I D D GKARYRY L NEQ Sbjct: 313 EIREMLELAAEKKVHPWIEEVPMKEANKAIQDMDAGKARYRYVLTNEQ 360 >ref|XP_746963.1| zinc-binding alcohol dehydrogenase [Aspergillus fumigatus Af293] gi|66844588|gb|EAL84925.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus fumigatus Af293] gi|159123847|gb|EDP48966.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus fumigatus A1163] Length = 361 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREML+LAA++ VHPWI+ER MKDAN+ +VD ++GKARYRY LVN+Q Sbjct: 314 EIREMLQLAAEKGVHPWIQERPMKDANQAVVDMNDGKARYRYVLVNDQ 361 >ref|XP_001275066.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus clavatus NRRL 1] gi|119403222|gb|EAW13640.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus clavatus NRRL 1] Length = 359 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 E+REML+LAA + VHPWI+ERSMKDAN+ ++D D GKARYRY LVN+Q Sbjct: 312 ELREMLQLAADKGVHPWIQERSMKDANQAVLDMDAGKARYRYVLVNDQ 359 >dbj|GAA90875.1| zinc-binding alcohol dehydrogenase [Aspergillus kawachii IFO 4308] Length = 360 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNE 133 EIREML LAA++KV PWIEERSMKDANK +V+ D GKARYRY L NE Sbjct: 313 EIREMLALAAEKKVQPWIEERSMKDANKAVVEMDAGKARYRYVLSNE 359 >ref|XP_001390518.1| quinone oxidoreductase [Aspergillus niger CBS 513.88] gi|134058207|emb|CAK38399.1| unnamed protein product [Aspergillus niger] gi|350633005|gb|EHA21372.1| Hypothetical protein ASPNIDRAFT_50766 [Aspergillus niger ATCC 1015] Length = 360 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNE 133 EIREML LAA++KV PWIEERSMKDANK +V+ D GKARYRY L NE Sbjct: 313 EIREMLALAAEKKVQPWIEERSMKDANKAVVEMDAGKARYRYVLSNE 359 >ref|XP_007581394.1| putative alcohol dehydrogenase superfamily zinc-containing protein [Neofusicoccum parvum UCRNP2] gi|485927003|gb|EOD51141.1| putative alcohol dehydrogenase superfamily zinc-containing protein [Neofusicoccum parvum UCRNP2] Length = 359 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EI+EMLELAA ++V PWI+ERSMKDAN+ +VD ++GKARYRY L+NE+ Sbjct: 309 EIKEMLELAAAKQVKPWIQERSMKDANQAVVDMEDGKARYRYVLINEK 356 >gb|ENH88929.1| nadp-dependent alcohol dehydrogenase [Colletotrichum orbiculare MAFF 240422] Length = 362 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 +I EMLELAAK+KV PW+++R +KDANK IVD + GKARYRY LVNE+ Sbjct: 311 DITEMLELAAKQKVKPWVQKRPLKDANKAIVDMEAGKARYRYVLVNEK 358 >ref|XP_001827625.1| quinone oxidoreductase [Aspergillus oryzae RIB40] gi|83776373|dbj|BAE66492.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391866319|gb|EIT75591.1| alcohol dehydrogenase, class V [Aspergillus oryzae 3.042] Length = 361 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLELAA++ V W++E MKDANK IVD D GKARYRY LVNEQ Sbjct: 314 EIREMLELAAEKNVRSWVQEVPMKDANKAIVDMDAGKARYRYVLVNEQ 361 >ref|XP_002384866.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus flavus NRRL3357] gi|220689579|gb|EED45930.1| zinc-binding alcohol dehydrogenase, putative [Aspergillus flavus NRRL3357] Length = 351 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLELAA++ V W++E MKDANK IVD D GKARYRY LVNEQ Sbjct: 304 EIREMLELAAEKNVRSWVQEVPMKDANKAIVDMDAGKARYRYVLVNEQ 351 >ref|XP_002560467.1| Pc16g00450 [Penicillium chrysogenum Wisconsin 54-1255] gi|211585090|emb|CAP92715.1| Pc16g00450 [Penicillium chrysogenum Wisconsin 54-1255] Length = 360 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLELAA + V PWI+ER MKDAN+ IVD D+G ARYRY L NEQ Sbjct: 313 EIREMLELAAAKGVKPWIQERPMKDANQAIVDMDKGDARYRYVLTNEQ 360 >gb|EMR67494.1| putative nadp-dependent alcohol dehydrogenase protein [Eutypa lata UCREL1] Length = 365 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNE 133 EI +ML+LAA++K+ PWI+ER +KDAN+ I+D +EGKARYRY LVNE Sbjct: 314 EIEDMLKLAAEKKIQPWIQERPLKDANQAIIDMEEGKARYRYVLVNE 360 >gb|EFQ32461.1| zinc-binding dehydrogenase [Colletotrichum graminicola M1.001] Length = 362 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLELA ++KV PW+++R MKDANK IVD + G ARYRY LVNE+ Sbjct: 311 EIREMLELAVEKKVKPWVQKRPMKDANKAIVDMEAGHARYRYVLVNEK 358 >gb|EPS26266.1| hypothetical protein PDE_01202 [Penicillium oxalicum 114-2] Length = 360 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREML+LAA +KV PW+EER MKDAN+ I D D G AR+RY LVN+Q Sbjct: 313 EIREMLDLAASKKVKPWVEERPMKDANQAIQDMDAGNARFRYVLVNDQ 360 >ref|XP_001598795.1| hypothetical protein SS1G_00884 [Sclerotinia sclerotiorum 1980] gi|154691743|gb|EDN91481.1| hypothetical protein SS1G_00884 [Sclerotinia sclerotiorum 1980 UF-70] Length = 362 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EI EMLE AAK K+HP+IEER M +AN++IVD ++GKAR+RY LVNE+ Sbjct: 308 EINEMLEFAAKNKIHPFIEERPMSEANQIIVDMEDGKARFRYVLVNEK 355 >gb|EKG21809.1| Alcohol dehydrogenase superfamily zinc-containing [Macrophomina phaseolina MS6] Length = 359 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/48 (62%), Positives = 43/48 (89%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 +I+EML+LAA+++V PW +ERS+KDAN+ IVD ++GKARYRY L+NE+ Sbjct: 309 QIKEMLDLAAEQQVKPWTQERSLKDANQAIVDMEDGKARYRYVLINEK 356 >gb|EYE91954.1| alcohol dehydrogenase [Aspergillus ruber CBS 135680] Length = 360 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EIREMLEL A++ V PWIEE MKDAN+ +VD + GKARYRY LVNEQ Sbjct: 313 EIREMLELVAEKNVKPWIEEIPMKDANRGLVDMEAGKARYRYVLVNEQ 360 >gb|ESZ90848.1| putative NADP-dependent alcohol dehydrogenase C 2 [Sclerotinia borealis F-4157] Length = 400 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNEQ 130 EI EMLE AAK K+HP I+ER M DAN+ IVD ++GKARYRY LVNE+ Sbjct: 346 EISEMLEFAAKNKIHPLIQERPMSDANQAIVDMEDGKARYRYVLVNEK 393 >gb|EPS26795.1| hypothetical protein PDE_01734 [Penicillium oxalicum 114-2] Length = 359 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNE 133 EIREM EL A++ + PWIEE SMK+ANK IVD ++GKARYRY LVN+ Sbjct: 313 EIREMFELVAEKSIQPWIEEVSMKEANKAIVDMEDGKARYRYVLVNQ 359 >ref|XP_002488258.1| zinc-binding alcohol dehydrogenase, putative [Talaromyces stipitatus ATCC 10500] gi|218713179|gb|EED12604.1| zinc-binding alcohol dehydrogenase, putative [Talaromyces stipitatus ATCC 10500] Length = 361 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -2 Query: 273 EIREMLELAAKEKVHPWIEERSMKDANKVIVDQDEGKARYRYTLVNE 133 +IRE+L LAA++K+ PWIEER MKDAN+ I+D ++GKARYRY LVNE Sbjct: 314 DIRELLALAAEKKIKPWIEERPMKDANQTILDLNDGKARYRYVLVNE 360