BLASTX nr result
ID: Paeonia22_contig00040381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040381 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830462.1| hypothetical protein AMTR_s00115p00112450 [A... 68 1e-09 ref|XP_002516402.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_002515778.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_006830462.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda] gi|548836835|gb|ERM97878.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda] Length = 61 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/49 (75%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = +1 Query: 220 ESEGLFAS--ARSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGFLRDRF 360 ESEG ARSSNS QQTGMV SKQL H RVPIGRQPF+GFLRDRF Sbjct: 2 ESEGKRGQPMARSSNSFQQTGMVQQSKQLHHSRVPIGRQPFQGFLRDRF 50 >ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis] gi|223544500|gb|EEF46019.1| conserved hypothetical protein [Ricinus communis] Length = 52 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/41 (73%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = -2 Query: 322 RWVHESDEVALTTEPCLSVGANWMIGPTQ--KAPHSPFPNM 206 RWV ES EVAL TEPCL VGANWMIGP PHSPFPN+ Sbjct: 12 RWVDESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI 52 >ref|XP_002515778.1| conserved hypothetical protein [Ricinus communis] gi|223545106|gb|EEF46617.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 255 QFAPTDRHGSVVKATSSLSCTHRTAALSGVP 347 QF PTDRHGSVVKATSSLSCT+RT ALSGVP Sbjct: 57 QFTPTDRHGSVVKATSSLSCTYRTIALSGVP 87