BLASTX nr result
ID: Paeonia22_contig00040329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040329 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363638.1| PREDICTED: uncharacterized protein LOC102601... 55 8e-06 ref|XP_005850831.1| hypothetical protein CHLNCDRAFT_48520 [Chlor... 55 8e-06 ref|XP_003064996.1| predicted protein [Micromonas pusilla CCMP15... 55 8e-06 >ref|XP_006363638.1| PREDICTED: uncharacterized protein LOC102601005 [Solanum tuberosum] Length = 212 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 233 PTVPVYYSAKLQPRKQT*QNWQRKKTVLSLTLICICEMT 117 PTVPVYY AK QPR++ QN + KKT+LSLTL+ +CEMT Sbjct: 174 PTVPVYYPAKPQPRERAWQNQRGKKTLLSLTLVRLCEMT 212 >ref|XP_005850831.1| hypothetical protein CHLNCDRAFT_48520 [Chlorella variabilis] gi|307110493|gb|EFN58729.1| hypothetical protein CHLNCDRAFT_48520 [Chlorella variabilis] Length = 55 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 233 PTVPVYYSAKLQPRKQT*QNWQRKKTVLSLTLICICEMT 117 PTVP+YY AK QPR++ + + KKT+LSLTL+C+CEMT Sbjct: 17 PTVPIYYLAKPQPRERAWKKQRGKKTLLSLTLVCLCEMT 55 >ref|XP_003064996.1| predicted protein [Micromonas pusilla CCMP1545] gi|226453532|gb|EEH50843.1| predicted protein [Micromonas pusilla CCMP1545] Length = 55 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 233 PTVPVYYSAKLQPRKQT*QNWQRKKTVLSLTLICICEMT 117 PTVPVYY AK QPR++ QN + KKT+LSLTL+ +CEMT Sbjct: 17 PTVPVYYPAKPQPRERAWQNQRGKKTLLSLTLVRLCEMT 55