BLASTX nr result
ID: Paeonia22_contig00040258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040258 (533 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035379.1| F-box and associated interaction domains-con... 47 8e-06 ref|XP_007035380.1| F-box and associated interaction domains-con... 47 8e-06 >ref|XP_007035379.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508714408|gb|EOY06305.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 476 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +1 Query: 1 GVLGFYLSILDYDPPHHSNCDIWIMKEYGVQNSWTKHFVIE--IPNYSGW 144 GVLG L I+ + + DIW+MKEYGV+ SWTK FVIE P W Sbjct: 284 GVLGGCLFIIYFT--NSIRFDIWVMKEYGVKESWTKQFVIENLYPKQGSW 331 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +2 Query: 152 YLPMKLLNNDEEILLLHNDKKLV*YNFEE*QVRFEDFWK 268 Y PM +LNN EIL+L+N+ +V YN + +R F++ Sbjct: 334 YEPMVVLNNG-EILMLYNNDAVVCYNQKRRNLRGTKFFR 371 >ref|XP_007035380.1| F-box and associated interaction domains-containing protein, putative isoform 2, partial [Theobroma cacao] gi|508714409|gb|EOY06306.1| F-box and associated interaction domains-containing protein, putative isoform 2, partial [Theobroma cacao] Length = 465 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +1 Query: 1 GVLGFYLSILDYDPPHHSNCDIWIMKEYGVQNSWTKHFVIE--IPNYSGW 144 GVLG L I+ + + DIW+MKEYGV+ SWTK FVIE P W Sbjct: 284 GVLGGCLFIIYFT--NSIRFDIWVMKEYGVKESWTKQFVIENLYPKQGSW 331 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +2 Query: 152 YLPMKLLNNDEEILLLHNDKKLV*YNFEE*QVRFEDFWK 268 Y PM +LNN EIL+L+N+ +V YN + +R F++ Sbjct: 334 YEPMVVLNNG-EILMLYNNDAVVCYNQKRRNLRGTKFFR 371