BLASTX nr result
ID: Paeonia22_contig00040180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040180 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62285.1| hypothetical protein L484_022173 [Morus notabilis] 60 4e-07 ref|XP_004304116.1| PREDICTED: protein ULTRAPETALA 1-like [Fraga... 59 5e-07 ref|XP_007216036.1| hypothetical protein PRUPE_ppa017439mg [Prun... 58 1e-06 ref|XP_006412985.1| hypothetical protein EUTSA_v10026038mg [Eutr... 58 2e-06 ref|XP_002278664.1| PREDICTED: protein ULTRAPETALA 1 [Vitis vini... 56 5e-06 >gb|EXB62285.1| hypothetical protein L484_022173 [Morus notabilis] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 479 GDAVGRLRVFINGDLEITCECTLGCQEGLFS 387 GDAVGRLRVF+NGDL+ITCECT GCQEG S Sbjct: 45 GDAVGRLRVFLNGDLQITCECTPGCQEGKLS 75 >ref|XP_004304116.1| PREDICTED: protein ULTRAPETALA 1-like [Fragaria vesca subsp. vesca] Length = 229 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 479 GDAVGRLRVFINGDLEITCECTLGCQEGLFS 387 GDAVGRLRVF+NG+LEITCECT GCQEG S Sbjct: 37 GDAVGRLRVFMNGELEITCECTPGCQEGTLS 67 >ref|XP_007216036.1| hypothetical protein PRUPE_ppa017439mg [Prunus persica] gi|462412186|gb|EMJ17235.1| hypothetical protein PRUPE_ppa017439mg [Prunus persica] Length = 236 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 479 GDAVGRLRVFINGDLEITCECTLGCQE 399 GDAVGRLRVF+NGDLEITCECT GCQE Sbjct: 44 GDAVGRLRVFVNGDLEITCECTPGCQE 70 >ref|XP_006412985.1| hypothetical protein EUTSA_v10026038mg [Eutrema salsugineum] gi|557114155|gb|ESQ54438.1| hypothetical protein EUTSA_v10026038mg [Eutrema salsugineum] Length = 256 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 479 GDAVGRLRVFINGDLEITCECTLGCQEGLFSSLCLS 372 GDA+ RLRVF NGDLEITCECT GC EGL SL S Sbjct: 44 GDAIARLRVFPNGDLEITCECTPGCDEGLSLSLSFS 79 >ref|XP_002278664.1| PREDICTED: protein ULTRAPETALA 1 [Vitis vinifera] gi|147771900|emb|CAN75705.1| hypothetical protein VITISV_031418 [Vitis vinifera] gi|297739267|emb|CBI28918.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 479 GDAVGRLRVFINGDLEITCECTLGCQE 399 GDAVGRLRVFI GDLEITCECT GCQE Sbjct: 43 GDAVGRLRVFIGGDLEITCECTPGCQE 69