BLASTX nr result
ID: Paeonia22_contig00040022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00040022 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320456.2| hypothetical protein POPTR_0014s14950g, part... 57 2e-06 >ref|XP_002320456.2| hypothetical protein POPTR_0014s14950g, partial [Populus trichocarpa] gi|550324232|gb|EEE98771.2| hypothetical protein POPTR_0014s14950g, partial [Populus trichocarpa] Length = 284 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = -2 Query: 150 RNIFSEKSNRRKP*LDPNKHVRKFKPTRLYKNKLECFTCGSPEHLSRTCP 1 + + KS+ RK L+P KHVRK +P+R Y NKL+ + C S H S+TCP Sbjct: 209 KRYYLRKSSARKSYLNPKKHVRKIRPSRTYPNKLKFYVCNSKGHFSKTCP 258