BLASTX nr result
ID: Paeonia22_contig00039802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039802 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD27902.1|AC006267_7 putative polyprotein [Arabidopsis thali... 60 3e-07 >gb|AAD27902.1|AC006267_7 putative polyprotein [Arabidopsis thaliana] gi|7267450|emb|CAB81146.1| putative polyprotein [Arabidopsis thaliana] Length = 1054 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = -2 Query: 241 CTESERIKLAVFRMGGDARSWWDSCIRYYGREALYA-SSWDDFR*MFEEKFVPTFEKVKL 65 C +S ++K+A + A SWWD + R Y +W+ + + ++FVP++ +L Sbjct: 124 CLQSNKVKIAATKFYNYALSWWDQLVTSRRRTRDYPIKTWNQLKFVMRKRFVPSYYHREL 183 Query: 64 REKYESLTQGSKTVEQYYLE 5 ++ +L QGSKTVE+Y+LE Sbjct: 184 HQRLRNLVQGSKTVEEYFLE 203