BLASTX nr result
ID: Paeonia22_contig00039797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039797 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28473.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002267175.1| PREDICTED: uncharacterized protein LOC100256... 56 6e-06 >emb|CBI28473.3| unnamed protein product [Vitis vinifera] Length = 934 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 211 NSTSTSKGLCKVVWTIEADLSDGQLLYVTGE 119 NS++ KGLCKV+WTIEADL DGQLLY+TG+ Sbjct: 78 NSSTAFKGLCKVIWTIEADLEDGQLLYITGD 108 >ref|XP_002267175.1| PREDICTED: uncharacterized protein LOC100256290 [Vitis vinifera] Length = 1019 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 211 NSTSTSKGLCKVVWTIEADLSDGQLLYVTGE 119 NS++ KGLCKV+WTIEADL DGQLLY+TG+ Sbjct: 78 NSSTAFKGLCKVIWTIEADLEDGQLLYITGD 108