BLASTX nr result
ID: Paeonia22_contig00039647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039647 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007026557.1| ARM repeat superfamily protein, putative iso... 60 2e-07 gb|EXB99395.1| hypothetical protein L484_016371 [Morus notabilis] 57 4e-06 gb|EXB99393.1| hypothetical protein L484_016369 [Morus notabilis] 57 4e-06 >ref|XP_007026557.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590627846|ref|XP_007026558.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590627849|ref|XP_007026559.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508715162|gb|EOY07059.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508715163|gb|EOY07060.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508715164|gb|EOY07061.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 943 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +2 Query: 71 MERIIWNRCEHIDASVKPLTPQTLVSVRSLIVNPSTSDSTISAIFETLIRSLQFSHD 241 ME+++ N E + +PL+ QTL S+RSL++NPSTSDST+S++ L RSLQ S D Sbjct: 1 MEQLVMNSIEQSLDNNQPLSFQTLASIRSLVINPSTSDSTLSSVLNALTRSLQLSRD 57 >gb|EXB99395.1| hypothetical protein L484_016371 [Morus notabilis] Length = 426 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 113 SVKPLTPQTLVSVRSLIVNPSTSDSTISAIFETLIRSLQFSHDERVL 253 S +PL+ Q+L +R+LI+NPST DSTIS++FETL RSL+ + D +L Sbjct: 14 SEEPLSAQSLTRIRALIINPSTPDSTISSLFETLTRSLELNRDPNLL 60 >gb|EXB99393.1| hypothetical protein L484_016369 [Morus notabilis] Length = 235 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +2 Query: 113 SVKPLTPQTLVSVRSLIVNPSTSDSTISAIFETLIRSLQFSHDERVL 253 S +PL+ Q+L +R+LI+NPST DSTIS++FETL RSL+ + D +L Sbjct: 14 SEEPLSAQSLTRIRALIINPSTPDSTISSLFETLTRSLELNRDTNLL 60