BLASTX nr result
ID: Paeonia22_contig00039626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039626 (258 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446272.1| hypothetical protein CICLE_v10014928mg [Citr... 59 5e-07 ref|XP_006470565.1| PREDICTED: uncharacterized protein LOC102611... 59 7e-07 ref|XP_002279963.2| PREDICTED: uncharacterized protein LOC100265... 57 4e-06 emb|CBI24231.3| unnamed protein product [Vitis vinifera] 57 4e-06 >ref|XP_006446272.1| hypothetical protein CICLE_v10014928mg [Citrus clementina] gi|557548883|gb|ESR59512.1| hypothetical protein CICLE_v10014928mg [Citrus clementina] Length = 519 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 252 QRDYMTKESFADNSPWTNRIKGSGMEMPSGFSEDETAETDYS 127 QRDY+ K S+A+ WTN IKGS EMPS FSEDETAET+ S Sbjct: 476 QRDYIAKASYAEIPRWTNPIKGSAAEMPSSFSEDETAETNSS 517 >ref|XP_006470565.1| PREDICTED: uncharacterized protein LOC102611835 isoform X1 [Citrus sinensis] gi|568832700|ref|XP_006470566.1| PREDICTED: uncharacterized protein LOC102611835 isoform X2 [Citrus sinensis] Length = 519 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 252 QRDYMTKESFADNSPWTNRIKGSGMEMPSGFSEDETAETDYS 127 QRDY+ K S+A+ WTN IKGS EMPS FSEDETAET S Sbjct: 476 QRDYIAKASYAEIPRWTNPIKGSAAEMPSSFSEDETAETSSS 517 >ref|XP_002279963.2| PREDICTED: uncharacterized protein LOC100265339 [Vitis vinifera] Length = 528 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 246 DYMTKESFADNSPWTNRIKGSGMEMPSGFSEDETAETDYS 127 DY K SF++ W N+IKGS MEMPS FSEDETAET S Sbjct: 487 DYAKKSSFSETPTWGNQIKGSAMEMPSSFSEDETAETSSS 526 >emb|CBI24231.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 246 DYMTKESFADNSPWTNRIKGSGMEMPSGFSEDETAETDYS 127 DY K SF++ W N+IKGS MEMPS FSEDETAET S Sbjct: 468 DYAKKSSFSETPTWGNQIKGSAMEMPSSFSEDETAETSSS 507