BLASTX nr result
ID: Paeonia22_contig00039601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039601 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [A... 86 4e-15 >ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] gi|548845810|gb|ERN05118.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] Length = 425 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/68 (58%), Positives = 52/68 (76%) Frame = +3 Query: 3 LIVDHDFSPRLLFHIIRCYLLLCTHARGFSVVMENLPHSIINGSFTEITEEFPVIGSLIE 182 L V+ D SPRLLFHIIRCY+LLCT RGF+++++ LP I N SF +ITEEFPVI ++E Sbjct: 266 LSVNKDHSPRLLFHIIRCYVLLCTDTRGFNMLIDYLPEPITNNSFQQITEEFPVIRRMLE 325 Query: 183 ELLLTLDK 206 +LL+ K Sbjct: 326 QLLMNTGK 333