BLASTX nr result
ID: Paeonia22_contig00039595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039595 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75283.1| hypothetical protein VITISV_029602 [Vitis vinifera] 56 5e-06 >emb|CAN75283.1| hypothetical protein VITISV_029602 [Vitis vinifera] Length = 1773 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/73 (38%), Positives = 43/73 (58%) Frame = +2 Query: 2 NKAPGIDGFTILFFQNSWEVVNGDLMKVFLELYSKVVINANEGSPFGIHAPL*NQRLRRK 181 NKAPG DGFTI FQ+ W+V+ DL++VF E + VIN + + F + P + + +K Sbjct: 1077 NKAPGPDGFTIAVFQDCWDVIKEDLVRVFXEFHRSXVINXSTNASFIVXLP--KKSMTKK 1134 Query: 182 S*TKHSVSIVASL 220 +S++ SL Sbjct: 1135 ISNFRPISLITSL 1147