BLASTX nr result
ID: Paeonia22_contig00039436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039436 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa] 43 1e-06 >gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa] Length = 1297 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = -2 Query: 109 KDHTQLWYLRLGHMSVRRIQELHRRHLLEGVEDCKL 2 +D T+LW RLGHMS R +QELH++ L+GV L Sbjct: 389 EDKTELWRRRLGHMSQRGLQELHKKEQLDGVMSAAL 424 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 224 KGSLIYMRGNKLPNNIYKLSGVTITSGS 141 KG ++YM+G P+N+YKL+G T+ G+ Sbjct: 356 KGQMVYMKGAIQPDNMYKLTGSTVEGGA 383