BLASTX nr result
ID: Paeonia22_contig00039403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039403 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007144779.1| hypothetical protein PHAVU_007G183900g [Phas... 71 2e-10 ref|XP_007208533.1| hypothetical protein PRUPE_ppa025537mg [Prun... 58 1e-06 >ref|XP_007144779.1| hypothetical protein PHAVU_007G183900g [Phaseolus vulgaris] gi|593688291|ref|XP_007144780.1| hypothetical protein PHAVU_007G183900g [Phaseolus vulgaris] gi|561017969|gb|ESW16773.1| hypothetical protein PHAVU_007G183900g [Phaseolus vulgaris] gi|561017970|gb|ESW16774.1| hypothetical protein PHAVU_007G183900g [Phaseolus vulgaris] Length = 470 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/95 (38%), Positives = 59/95 (62%) Frame = +2 Query: 62 VKTAKDMNDFNMAKGMEFNSTNDAYELRITKVEDFKSAQDVFFKTSNDTNELKIIKDVKP 241 V + K++N K +EF + N+ EL+ KVE+ K +D+ K + ELK+ K+ + Sbjct: 318 VNSVKELNPETELKNLEFKTVNNIEELKPEKVEELKMTKDMELKALKNVEELKLEKEAEL 377 Query: 242 RPNKNTDDLKLAKDFEELTSKLNVLEAKLSEAGST 346 R +K+ ++LKL K EE+ KL+ LEAKL+E+G T Sbjct: 378 RVSKSIEELKLMKAIEEMKLKLDGLEAKLNESGLT 412 >ref|XP_007208533.1| hypothetical protein PRUPE_ppa025537mg [Prunus persica] gi|462404175|gb|EMJ09732.1| hypothetical protein PRUPE_ppa025537mg [Prunus persica] Length = 312 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/91 (42%), Positives = 51/91 (56%) Frame = +2 Query: 62 VKTAKDMNDFNMAKGMEFNSTNDAYELRITKVEDFKSAQDVFFKTSNDTNELKIIKDVKP 241 +K AKD+ + K +E D ELR K + K QDV K S ELK+ +DV+ Sbjct: 220 LKPAKDV-ELRPEKDVELRPEKDV-ELRPAKDVELKPTQDVELKPSKAV-ELKLARDVEL 276 Query: 242 RPNKNTDDLKLAKDFEELTSKLNVLEAKLSE 334 K +DLKL KD +E+ SKLN LE KLS+ Sbjct: 277 NAEKIVEDLKLVKDIQEIKSKLNELELKLSQ 307