BLASTX nr result
ID: Paeonia22_contig00039279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039279 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ14630.1| hypothetical protein OsJ_04554 [Oryza sativa Japo... 52 3e-06 gb|EMS48143.1| Small ubiquitin-related modifier 1 [Triticum urartu] 49 8e-06 >gb|EAZ14630.1| hypothetical protein OsJ_04554 [Oryza sativa Japonica Group] Length = 151 Score = 52.0 bits (123), Expect(2) = 3e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 20 DKDGNEVMFKIKKTTQLRKLMNAYCDCQSL 109 D+DGNEV F+IK++TQL+KLMNAYCD QS+ Sbjct: 78 DQDGNEVFFRIKRSTQLKKLMNAYCDRQSV 107 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 121 KAIAFLFDGRR 153 K+IAFLFDGRR Sbjct: 110 KSIAFLFDGRR 120 >gb|EMS48143.1| Small ubiquitin-related modifier 1 [Triticum urartu] Length = 167 Score = 49.3 bits (116), Expect(2) = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 26 DGNEVMFKIKKTTQLRKLMNAYCDCQSL 109 DGNEV F+IK++TQL+KLMNAYCD QS+ Sbjct: 94 DGNEVFFRIKRSTQLKKLMNAYCDRQSV 121 Score = 25.8 bits (55), Expect(2) = 8e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 121 KAIAFLFDGRR 153 KAIAFLFDGRR Sbjct: 124 KAIAFLFDGRR 134