BLASTX nr result
ID: Paeonia22_contig00039161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039161 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521979.1| pentatricopeptide repeat-containing protein,... 59 5e-07 ref|XP_002325338.2| pentatricopeptide repeat-containing family p... 58 2e-06 ref|XP_003555569.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_007030408.1| Pentatricopeptide repeat superfamily protein... 57 3e-06 ref|XP_004304773.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_002521979.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538783|gb|EEF40383.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 496 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/53 (49%), Positives = 41/53 (77%) Frame = -2 Query: 395 VIEVMTSDRSKLDETVYSSIVKGVADSGMIKEATEIRQKLIEQKFLKEEIVLN 237 V+E+M S R K DE +YS+++ +AD+GM++EA E+RQKLI K LK++ +L+ Sbjct: 442 VLEIMISSRCKPDEEIYSALINSLADAGMMEEANELRQKLINIKVLKDQSILH 494 >ref|XP_002325338.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550316701|gb|EEE99719.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 443 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -2 Query: 395 VIEVMTSDRSKLDETVYSSIVKGVADSGMIKEATEIRQKLIEQKFLK 255 V+E+M S R K DE +YS+++K VAD+GM++EA E+ QKLIE+K L+ Sbjct: 391 VLEMMISGRYKPDEEIYSTLIKSVADAGMVEEADELHQKLIERKVLR 437 >ref|XP_003555569.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like isoform X1 [Glycine max] gi|571569757|ref|XP_006606448.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like isoform X2 [Glycine max] Length = 589 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -2 Query: 395 VIEVMTSDRSKLDETVYSSIVKGVADSGMIKEATEIRQKLIEQKFLKEEIVLN 237 V+++M + DE +YS+++K VAD GM+KEA ++ Q LI+ K LK+EI+LN Sbjct: 537 VLDLMVKGQCNPDERIYSALIKAVADGGMLKEANDLHQTLIKWKILKKEIMLN 589 >ref|XP_007030408.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508719013|gb|EOY10910.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 595 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/53 (49%), Positives = 40/53 (75%) Frame = -2 Query: 395 VIEVMTSDRSKLDETVYSSIVKGVADSGMIKEATEIRQKLIEQKFLKEEIVLN 237 V+E+M S R K DET +I+KG+AD+GM++EA ++RQKL+E K +E +L+ Sbjct: 543 VLEMMVSSRCKPDETTCWTIIKGIADAGMMEEANKLRQKLMEWKVFRERTLLS 595 >ref|XP_004304773.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Fragaria vesca subsp. vesca] Length = 583 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = -2 Query: 395 VIEVMTSDRSKLDETVYSSIVKGVADSGMIKEATEIRQKLIEQKFLKEE 249 V+E+M SD+ DE +YS+I++GV +GM KEA ++RQKLIE K ++EE Sbjct: 533 VLEMMISDQCMPDEAIYSTILQGVTAAGMTKEADQLRQKLIEWKVVQEE 581