BLASTX nr result
ID: Paeonia22_contig00039078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00039078 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCE31962.1| related to single-stranded TG1-3 binding protein... 97 2e-18 gb|EOO01403.1| putative glycine-rich protein [Togninia minima UC... 97 3e-18 ref|XP_007293127.1| RNP domain protein [Marssonina brunnea f. sp... 96 5e-18 ref|XP_006966102.1| predicted protein [Trichoderma reesei QM6a] ... 95 9e-18 ref|XP_007600034.1| RNA recognition domain-containing protein [C... 94 2e-17 gb|EFQ27704.1| RNA recognition domain-containing protein [Collet... 94 2e-17 gb|EXV00854.1| RNA recognition motif (RRM) superfamily protein [... 94 3e-17 gb|ELR06351.1| hypothetical protein GMDG_07941 [Pseudogymnoascus... 94 3e-17 gb|EFZ04164.1| glycine-rich protein [Metarhizium anisopliae ARSE... 94 3e-17 gb|EFY86053.1| RNP domain protein [Metarhizium acridum CQMa 102] 94 3e-17 gb|EPE06907.1| rnp domain protein [Ophiostoma piceae UAMH 11346] 93 3e-17 gb|EQB56643.1| hypothetical protein CGLO_03333 [Colletotrichum g... 93 4e-17 gb|ENH80535.1| rnp domain protein [Colletotrichum orbiculare MAF... 93 4e-17 ref|XP_007273381.1| rnp domain-containing protein [Colletotrichu... 93 4e-17 gb|EHK43509.1| hypothetical protein TRIATDRAFT_301301 [Trichoder... 93 4e-17 gb|EHK20344.1| hypothetical protein TRIVIDRAFT_127694, partial [... 93 4e-17 gb|EGY13663.1| glycine-rich protein [Verticillium dahliae VdLs.17] 93 4e-17 ref|XP_003009051.1| RNP domain-containing protein [Verticillium ... 93 4e-17 gb|EXM31862.1| hypothetical protein FOTG_03537 [Fusarium oxyspor... 92 7e-17 gb|EXM31861.1| hypothetical protein FOTG_03537 [Fusarium oxyspor... 92 7e-17 >emb|CCE31962.1| related to single-stranded TG1-3 binding protein [Claviceps purpurea 20.1] Length = 374 Score = 97.4 bits (241), Expect = 2e-18 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAIAELSGK++LERKVSVQLARKPET AEK Sbjct: 81 PRTDRPVGYAFVDLSTPSEAERAIAELSGKDVLERKVSVQLARKPETAAEK 131 >gb|EOO01403.1| putative glycine-rich protein [Togninia minima UCRPA7] Length = 361 Score = 96.7 bits (239), Expect = 3e-18 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE AEK Sbjct: 81 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPEPNAEK 131 >ref|XP_007293127.1| RNP domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863722|gb|EKD16769.1| RNP domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 368 Score = 95.9 bits (237), Expect = 5e-18 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRT+RPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE+ AEK Sbjct: 89 PRTERPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPESNAEK 139 >ref|XP_006966102.1| predicted protein [Trichoderma reesei QM6a] gi|340517811|gb|EGR48054.1| predicted protein [Trichoderma reesei QM6a] gi|572278893|gb|ETS02044.1| RNA-binding domain-containing protein [Trichoderma reesei RUT C-30] Length = 358 Score = 95.1 bits (235), Expect = 9e-18 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE EK Sbjct: 83 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPEPAGEK 133 >ref|XP_007600034.1| RNA recognition domain-containing protein [Colletotrichum fioriniae PJ7] gi|588894264|gb|EXF76273.1| RNA recognition domain-containing protein [Colletotrichum fioriniae PJ7] Length = 371 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 81 PRTDRPVGYAFVDLSTPSEAERAISELSGKEILERKVSVQLARKPEPAGEK 131 >gb|EFQ27704.1| RNA recognition domain-containing protein [Colletotrichum graminicola M1.001] Length = 367 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 81 PRTDRPVGYAFVDLSTPSEAERAISELSGKEILERKVSVQLARKPEPAGEK 131 >gb|EXV00854.1| RNA recognition motif (RRM) superfamily protein [Metarhizium robertsii] Length = 363 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRT+RPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE EK Sbjct: 82 PRTERPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPEPAGEK 132 >gb|ELR06351.1| hypothetical protein GMDG_07941 [Pseudogymnoascus destructans 20631-21] Length = 347 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTPSEAERAI ELSGKEILERKVSVQLARKPE EK Sbjct: 82 PRTDRPVGYAFVDLSTPSEAERAITELSGKEILERKVSVQLARKPEPAGEK 132 >gb|EFZ04164.1| glycine-rich protein [Metarhizium anisopliae ARSEF 23] Length = 343 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRT+RPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE EK Sbjct: 82 PRTERPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPEPAGEK 132 >gb|EFY86053.1| RNP domain protein [Metarhizium acridum CQMa 102] Length = 363 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRT+RPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPE EK Sbjct: 82 PRTERPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPEPAGEK 132 >gb|EPE06907.1| rnp domain protein [Ophiostoma piceae UAMH 11346] Length = 342 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRT+RPVGYAFVDLSTP+EA+RA+ ELSGKEILERKVSVQLARKPET AEK Sbjct: 79 PRTERPVGYAFVDLSTPNEADRAVTELSGKEILERKVSVQLARKPETAAEK 129 >gb|EQB56643.1| hypothetical protein CGLO_03333 [Colletotrichum gloeosporioides Cg-14] Length = 374 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 81 PRTDRPVGYAFVDLSTPTEAERAISELSGKEILERKVSVQLARKPEPAGEK 131 >gb|ENH80535.1| rnp domain protein [Colletotrichum orbiculare MAFF 240422] Length = 378 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 81 PRTDRPVGYAFVDLSTPTEAERAISELSGKEILERKVSVQLARKPEPAGEK 131 >ref|XP_007273381.1| rnp domain-containing protein [Colletotrichum gloeosporioides Nara gc5] gi|429863007|gb|ELA37592.1| rnp domain-containing protein [Colletotrichum gloeosporioides Nara gc5] Length = 327 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 81 PRTDRPVGYAFVDLSTPTEAERAISELSGKEILERKVSVQLARKPEPAGEK 131 >gb|EHK43509.1| hypothetical protein TRIATDRAFT_301301 [Trichoderma atroviride IMI 206040] Length = 361 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EA+RAIAELSGKEILERKVSVQLARKPE EK Sbjct: 82 PRTDRPVGYAFVDLSTPNEADRAIAELSGKEILERKVSVQLARKPEPAGEK 132 >gb|EHK20344.1| hypothetical protein TRIVIDRAFT_127694, partial [Trichoderma virens Gv29-8] Length = 341 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EA+RAIAELSGKEILERKVSVQLARKPE EK Sbjct: 69 PRTDRPVGYAFVDLSTPNEADRAIAELSGKEILERKVSVQLARKPEPAGEK 119 >gb|EGY13663.1| glycine-rich protein [Verticillium dahliae VdLs.17] Length = 375 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 83 PRTDRPVGYAFVDLSTPTEAERAISELSGKEILERKVSVQLARKPEPAGEK 133 >ref|XP_003009051.1| RNP domain-containing protein [Verticillium alfalfae VaMs.102] gi|261352197|gb|EEY14625.1| RNP domain-containing protein [Verticillium alfalfae VaMs.102] Length = 300 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI+ELSGKEILERKVSVQLARKPE EK Sbjct: 83 PRTDRPVGYAFVDLSTPTEAERAISELSGKEILERKVSVQLARKPEPAGEK 133 >gb|EXM31862.1| hypothetical protein FOTG_03537 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 389 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI ELSGKEILERKVSVQLARKPE EK Sbjct: 86 PRTDRPVGYAFVDLSTPTEAERAIEELSGKEILERKVSVQLARKPEPAGEK 136 >gb|EXM31861.1| hypothetical protein FOTG_03537 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 407 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -1 Query: 237 PRTDRPVGYAFVDLSTPSEAERAIAELSGKEILERKVSVQLARKPETTAEK 85 PRTDRPVGYAFVDLSTP+EAERAI ELSGKEILERKVSVQLARKPE EK Sbjct: 86 PRTDRPVGYAFVDLSTPTEAERAIEELSGKEILERKVSVQLARKPEPAGEK 136